Prompt Library · v2.1 2191 prompts

The prompts
we actually use.

Practitioner SEO/GEO prompts for audits, briefs, ranking diagnostics, and content strategy. Tagged, versioned, and forkable. New prompts publish daily.

GEO v1.0

AI Mode SERP Visibility Plan

Builds a tactical plan to improve brand and content visibility in Google's AI Mode results.

Audit the current AI Mode results for {domain}'s top 20 target queries. For each query, record whether {domain} appears in the AI-generated answer, which competitors do, and what content attributes their cited pages share. Produce a 30/60/90-day visibility improvement plan...
geoai-modevisibility
GEO v1.0

AI Overview Source Eligibility

Evaluates whether a page meets the structural and authority signals needed to be cited in AI Overviews.

Assess the following page content and metadata from {url} against known AI Overview source eligibility signals: E-E-A-T indicators, structured data presence, factual density, citation-worthy claim formatting, and topical authority. Score eligibility and list the top 5 improvements...
geoai-overviewe-e-a-t
Content v1.0

Anchor Text Strategy Planner

Builds a diversified internal anchor text strategy for a target page to strengthen topical relevance signals.

For the target page {target_url} on {domain}, analyze the current internal anchor text distribution pointing to it. Identify over-optimized exact-match anchors, missing topical variation, and pages that should link but don't. Output a revised anchor text plan with 20 recommended internal link placements...
contentanchor-textinternal-links
Ranking v1.0

Branded vs Non-Branded Traffic Split

Segments organic traffic into branded and non-branded streams and benchmarks the split against industry norms.

Analyze the Search Console query data for {domain} and segment all queries into branded (containing {brand_terms}) and non-branded. Calculate traffic share, CTR, and average position for each segment. Compare the split to industry benchmarks and recommend strategies to grow non-branded organic share...
rankingbrandedanalytics
GEO v1.0

ChatGPT Citation Forecast Model

Predicts the likelihood of a page being cited by ChatGPT based on content and authority factors.

Analyze the content, backlink profile summary, and entity associations for {url}. Using citation likelihood heuristics (source authority, factual specificity, recency, structural clarity), forecast the probability of ChatGPT citing this page for queries in {topic_cluster} and list actionable improvements...
geochatgptcitation
GEO v1.0

Citation Context Optimization Brief

Rewrites page sections to maximize the probability of being quoted verbatim by generative AI engines.

Review the following page content from {url} and identify the 5 passages most likely to be cited verbatim by AI engines. For each, rewrite the passage to improve citation pull: increase factual specificity, add attribution signals, sharpen claim boundaries, and ensure self-contained readability...
geocitationcontent
Content v1.0

Content Brief Authority Builder

Generates a content brief that embeds E-E-A-T proof points, expert quotes, and trust signals throughout.

Create a full content brief for the topic '{topic}' targeting '{primary_keyword}'. Include: recommended word count, H2/H3 structure, E-E-A-T signal placements (author credentials box, primary research hooks, expert quote prompts), key claims to substantiate, and internal linking anchors...
contente-e-a-tbrief
Content v1.0

Content Decay Recovery Planner

Diagnoses traffic-declining pages and builds a refresh plan prioritized by recovery ROI.

Analyze the traffic trend data for the following URLs on {domain}. For each page showing >20% YoY organic traffic decline, diagnose the decay cause (freshness, competitor displacement, intent shift, index coverage), and output a refresh action plan with estimated effort, timeline, and traffic recovery potential...
contentrefreshdecay
Content v1.0

Content Gap Priority Matrix

Scores content gaps by search volume, competition, and business value to produce a prioritized creation queue.

Using the keyword gap data between {domain} and competitors {competitor_list}, score each content gap opportunity across three dimensions: search volume, keyword difficulty, and business relevance. Output a prioritized content creation matrix with recommended page type and estimated time-to-rank for the top 20 gaps...
contentgap-analysisprioritization
Content v1.0

Content Outline SERP-Aligned

Builds a content outline derived from SERP analysis to match dominant intent and coverage patterns.

Analyze the top 10 ranking pages for '{target_keyword}' and extract the H2/H3 structure, word count, media types, and schema used. Synthesize a superior content outline for {domain} that matches dominant intent, fills coverage gaps, and targets at least one featured snippet opportunity per section...
contentoutlineserp
Audit v1.0

Core Web Vitals Diagnostics

Diagnoses LCP, INP, and CLS failures from field or lab data and maps fixes to root causes.

Given the following CrUX/PageSpeed Insights data for {url}, identify the primary root cause for each failing Core Web Vital (LCP, INP, CLS), correlate each cause to a specific element or resource, and output a developer-ready fix specification with expected metric improvement...
auditcwvperformance
Audit v1.0

Crawl Budget Waste Detector

Surfaces URL patterns wasting crawl budget via parameterized, thin, or duplicate pages.

Using the crawl data below for {domain}, identify URL patterns (e.g., faceted parameters, session IDs, duplicate slugs) that are consuming crawl budget without delivering indexable value. Rank waste sources by estimated crawl cost and suggest robots.txt or canonical fixes...
auditcrawltechnical
Audit v1.0

Duplicate Content Cluster Finder

Groups near-duplicate URLs into clusters and recommends canonical consolidation actions.

Analyze the following set of URLs and page titles from {domain} for content duplication. Cluster URLs with substantially similar content, identify the strongest canonical candidate per cluster based on backlinks and traffic signals, and output a canonical consolidation map...
auditduplicatescanonical
Technical v1.0

Edge SEO Worker Spec

Specifies a Cloudflare Worker or edge function to apply SEO header and redirect logic at the CDN layer.

Write a Cloudflare Worker script for {domain} that: (1) injects canonical tags for parameterized URLs matching {pattern}, (2) sets x-robots-tag: noindex for {noindex_paths}, (3) applies 301 redirects for the URL map {redirect_map}, and (4) adds recommended security headers (HSTS, X-Frame-Options, CSP)...
technicaledge-seocloudflare
Content v1.0

E-E-A-T Content Scoring Rubric

Scores existing content against Google's E-E-A-T quality criteria and outputs a detailed improvement list.

Score the following page content from {url} against each E-E-A-T dimension: Experience (first-hand evidence), Expertise (depth and accuracy), Authoritativeness (brand/author signals), and Trustworthiness (citations, transparency). Provide a 1–10 score per dimension with specific content edits to improve each score...
contente-e-a-tquality
GEO v1.0

Entity Brand Association Builder

Maps which entities and topics an LLM associates with a brand and flags missing associations.

Query {llm_model} with prompts designed to elicit entity associations for {brand}. Extract the concepts, people, products, and categories the model connects to the brand. Compare against {brand}'s target entity map and identify association gaps requiring content or PR action...
geoentitybrand
Content v1.0

FAQ Schema Content Generator

Generates FAQ content blocks optimized for both FAQ schema markup and featured snippet eligibility.

Generate 10 FAQ question-and-answer pairs for the topic '{topic}' targeting the keyword cluster {keywords}. Each answer must be 40–60 words, factually accurate, self-contained, and structured to qualify for FAQPage schema. Output both the human-readable HTML version and the JSON-LD schema block...
contentfaqschema
Ranking v1.0

Featured Snippet Gap Targeter

Identifies queries where competitors hold featured snippets that {domain} is positioned to displace.

Using the SERP data below, identify queries in {topic} where a competitor holds a featured snippet and {domain} ranks in positions 2–10. For each opportunity, extract the current snippet format (paragraph, list, table), draft a replacement snippet block optimized to win the position...
rankingfeatured-snippetcompetitor
GEO v1.0

GEO Content Brief Builder

Generates a content brief optimized for generative engine citation rather than traditional SERP ranking.

Create a GEO-optimized content brief for the topic '{topic}' targeting citation in AI-generated answers. Include: recommended answer-layer structure, entities to associate, claim density targets, ideal source citation format, E-E-A-T proof points to embed, and FAQ clusters likely to trigger AI retrieval...
geocontent-briefai-overview
Technical v1.0

Hreflang Config Code Builder

Generates correct hreflang HTML annotations or HTTP header equivalents for international page sets.

Generate complete hreflang annotations for the following international page set on {domain}: {page_locale_mapping}. Output both the HTML <link rel='alternate'> version and the HTTP header equivalent. Include x-default assignment, validate return-link symmetry, and flag any locale code errors...
technicalhreflanginternational
Audit v1.0

Hreflang Implementation Audit

Validates hreflang tag syntax, return-link consistency, and language-locale targeting accuracy.

Review the hreflang annotations for {domain} extracted below. Check for: missing return links, incorrect ISO 639-1/3166-1 codes, x-default misuse, conflicts with canonical tags, and pages excluded from the cluster. Output a fix-ready correction table...
audithreflanginternational
Audit v1.0

Indexing Coverage Report Builder

Diagnoses why pages are excluded from Google's index using Search Console coverage data.

Analyze the Google Search Console index coverage export for {domain}. Categorize all excluded URLs by reason (noindex, soft 404, crawl anomaly, etc.), estimate SEO impact per category, and produce a remediation roadmap ordered by priority...
auditindexingsearch-console
Technical v1.0

INP LCP CLS Root Cause Fix

Maps Core Web Vitals metric failures to specific DOM elements, resources, and code patterns with fixes.

Given the Lighthouse and CrUX traces for {url} below, identify the exact DOM elements, JavaScript execution patterns, and resource loading sequences causing LCP delay, INP latency, and CLS shifts. For each root cause, provide a specific code-level or server-configuration fix with expected metric delta...
technicalcwvperformance
Audit v1.0

JS Rendering Verification Audit

Compares raw HTML with rendered DOM to identify content hidden from search engine crawlers.

Compare the raw HTML source and the fully rendered DOM for {url} provided below. Identify all content, links, and structured data present only in the rendered version, assess crawlability risk for each, and recommend whether SSR, dynamic rendering, or prerendering is warranted...
auditjavascriptrendering
Technical v1.0

JSON-LD Schema Code Generator

Generates valid JSON-LD schema markup for a specified page type with all recommended properties populated.

Generate a complete, valid JSON-LD schema block for a {schema_type} page with the following details: {page_details}. Include all required and recommended properties per schema.org spec, nest related entities correctly, and add @context and @type declarations. Validate against Google's Rich Results requirements...
technicalschemajson-ld
Ranking v1.0

Keyword Cannibalization Resolver

Detects pages competing for the same keyword and recommends consolidation or differentiation fixes.

Analyze the following ranking data for {domain} and identify all keyword cannibalization instances where 2+ pages rank for the same primary query. For each conflict, recommend: consolidate via redirect, differentiate via intent re-targeting, or establish a clear canonical signal. Include expected ranking impact...
rankingcannibalizationkeywords
GEO v1.0

LLM Source Preference Drift Tracker

Monitors shifts in which sources an LLM prefers to cite for a topic set over time.

Compare the citation sources returned by {llm_model} for the query set {queries} at time T1 versus T2 (data provided below). Identify sources that gained or lost citation frequency, hypothesize causes (content updates, authority shifts, recency), and flag opportunities for {domain}...
geocitationtracking
Ranking v1.0

Local Pack Ranking Audit

Diagnoses why a business is under-ranking in Google's local 3-pack for target geo-queries.

Analyze the local pack rankings for '{business_name}' across the queries {local_queries} in {location}. Compare GBP completeness, review velocity, citation consistency, and proximity factors against the top 3 ranking businesses. Output a prioritized local ranking action plan...
rankinglocalgbp
Audit v1.0

Log File SEO Analyzer

Parses server log data to surface crawl frequency, bot behavior, and wasted crawl budget.

Analyze the following server log extract for {domain} and identify: (1) which URLs Googlebot crawled most/least, (2) crawl frequency patterns, (3) non-canonical URLs receiving bot attention, and (4) any 4xx/5xx responses served to crawlers. Output a prioritized action table...
auditcrawllogs
Audit v1.0

Mobile-First Readiness Checker

Evaluates a page's mobile-first indexing compliance across content parity and UX signals.

Audit the following mobile and desktop HTML snapshots for {url} and flag: (1) content present on desktop but absent on mobile, (2) missing or incorrect viewport meta tags, (3) touch-target sizing issues, (4) blocked resources on mobile, and (5) structured data parity gaps...
auditmobileindexing
GEO v1.0

Multi-LLM Response Comparison

Tests how ChatGPT, Claude, Gemini, and Perplexity respond to the same query to surface citation divergence.

Submit the query '{query}' to ChatGPT, Claude, Gemini, and Perplexity. For each response, extract: cited sources, answer framing, entities mentioned, and {brand} inclusion. Produce a divergence matrix and identify which LLM represents the highest citation opportunity for {domain}...
geomulti-llmcitation
Ranking v1.0

News SERP Inclusion Checker

Evaluates whether a publication meets Google News inclusion signals and surfaces indexing barriers.

Audit {domain} for Google News SERP eligibility: check for NewsArticle schema implementation, publication date markup, byline and author entity signals, freshness of content, and Google News sitemap configuration. Identify the top blockers preventing news carousel inclusion...
rankingnewsschema
Ranking v1.0

People Also Ask Cluster Miner

Extracts and clusters PAA questions for a seed topic to build FAQ and content expansion strategies.

For the seed query '{seed_query}', extract all People Also Ask questions visible across the first three SERP layers. Cluster questions by sub-theme, identify which clusters {domain} has no content for, and generate a prioritized FAQ expansion plan with recommended page placement...
rankingpaafaq
GEO v1.0

Perplexity Source Gap Analysis

Identifies which competitor sources Perplexity cites for target queries that your content is missing.

For the query set {queries}, compare the sources Perplexity.ai cites in its answers against the content available at {domain}. Identify topical gaps, structural weaknesses, and authority deficiencies preventing {domain} from being cited. Output a gap-fix brief per query cluster...
geoperplexitycitation
Technical v1.0

Prerender SEO Eligibility Check

Determines whether a site qualifies for prerendering and specifies the correct implementation approach.

Evaluate {domain}'s JavaScript architecture against prerendering eligibility criteria: content stability after load, absence of user-specific personalization in crawlable zones, and compatibility with {prerender_service}. Recommend a prerender configuration including bot-detection logic, cache TTL settings, and URL inclusion/exclusion rules...
technicalprerenderjavascript
Content v1.0

Programmatic Content Seed Builder

Designs a programmatic SEO content template and seed data model for scalable page generation.

Design a programmatic content template for '{page_type}' pages on {domain}. Specify: the dynamic variables required per page, the static content sections, the schema type and required properties, the internal linking logic, and a quality threshold checklist to prevent thin content at scale...
contentprogrammatictemplate
Audit v1.0

Redirect Chain Depth Audit

Flags multi-hop redirect chains that dilute PageRank and slow crawl efficiency.

Given the following redirect log for {domain}, identify all chains of 2 or more hops, classify each as temporary or permanent, estimate the PageRank loss per chain, and output a consolidation plan with the recommended single final destination URL for each chain...
auditredirectscrawl
Technical v1.0

Redirect Strategy Spec Builder

Produces a redirect implementation plan for a site migration, consolidation, or URL restructure.

Create a redirect implementation spec for the {migration_type} of {domain}. Map each old URL pattern to its new destination, specify 301 vs 302 usage with justification, identify redirect chains to eliminate, estimate crawl re-indexing timeline, and provide the .htaccess or Nginx rule syntax for each redirect group...
technicalredirectsmigration
Technical v1.0

Render Budget Allocation Plan

Estimates Googlebot's rendering budget consumption and recommends allocation across page priority tiers.

Using the JavaScript complexity metrics and crawl frequency data for {domain}, estimate the rendering budget consumed by each page template. Tier pages by SEO value (high/medium/low), recommend which templates should be server-rendered vs. client-rendered to maximize rendering budget efficiency, and output a resource hint plan...
technicalrender-budgetjavascript
Technical v1.0

Robots.txt Rules Architect

Designs an optimized robots.txt configuration to protect crawl budget and block non-indexable content.

Design a production-ready robots.txt file for {domain}. Block all URL patterns that are non-indexable (admin paths, cart/checkout, search results, duplicate parameter variants), preserve crawl access to all canonical content, include sitemap declarations, and add separate rules for GPTBot, Claude-Web, and PerplexityBot...
technicalrobots-txtcrawl
Audit v1.0

Schema Coverage Gap Audit

Identifies missing or incomplete schema types across key page templates on a site.

Review the following list of page types and URLs for {domain} and flag which schema types are absent, partially implemented, or misconfigured. For each gap, specify the recommended schema type, required properties, and estimated rich-result eligibility...
auditschemarich-results
Technical v1.0

Security Headers SEO Config

Generates a security header configuration that satisfies both security requirements and SEO rendering needs.

Generate a production-ready HTTP security header configuration for {domain} that includes: HSTS with preload, a CSP policy that does not block Googlebot rendering of {framework} assets, X-Frame-Options, X-Content-Type-Options, Referrer-Policy, and Permissions-Policy. Flag any CSP directive that could cause rendering issues...
technicalsecurity-headerscsp
Ranking v1.0

SERP Intent Depth Classifier

Classifies a keyword list by search intent type and intent depth to guide content format decisions.

Classify each keyword in the list {keywords} by primary intent (informational, navigational, commercial, transactional) and intent depth (awareness, consideration, decision). For each, recommend the optimal content format, page type, and funnel placement. Output as a structured CSV...
rankingintentkeywords
Ranking v1.0

SERP Volatility Signal Report

Analyzes ranking fluctuation patterns to determine if volatility is algorithm-driven or site-specific.

Using the 90-day rank tracking data below for {domain}, identify queries with high position variance (>5 positions). Cross-reference volatility spikes with known algorithm update dates, competitor activity, and on-page change logs. Classify each volatile query as algorithm-sensitive, competitor-driven, or self-inflicted...
rankingvolatilityalgorithm
Ranking v1.0

Shopping SERP Listing Optimizer

Audits product feed attributes and landing page signals to improve Google Shopping SERP placement.

Review the product feed data and landing page content for {product_set} on {domain}. Identify attribute gaps (missing GTINs, weak titles, absent price/availability schema), compare against top Shopping SERP placements for {target_queries}, and produce a feed optimization checklist...
rankingshoppingproduct
Technical v1.0

SSR vs CSR Render Decision Audit

Evaluates a JavaScript-heavy site's rendering architecture and recommends SSR, SSG, or ISR strategy.

Audit the rendering architecture of {domain} by comparing Googlebot's rendered output against the raw HTML for the key page templates listed. For each template, classify the current rendering model (CSR/SSR/SSG/ISR), identify SEO-critical content rendered only client-side, and recommend the optimal rendering strategy with implementation notes...
technicalrenderingjavascript
Content v1.0

Title Tag CTR Optimizer

Rewrites title tags using CTR-driving patterns while preserving keyword targeting and brand consistency.

Rewrite the following title tags for {domain} to improve organic CTR. For each, apply: primary keyword front-loading, power word insertion, number/bracket format where appropriate, and character count optimization (50–60 chars). Provide 3 variants per title with a predicted CTR impact rationale...
contenttitle-tagctr
Content v1.0

Topic Cluster Architecture Planner

Designs a pillar-cluster content architecture for a topic area with URL structure and interlinking logic.

Design a full topic cluster architecture for '{core_topic}' on {domain}. Output: one pillar page brief, 8–12 cluster page titles with target keywords, recommended URL slugs, internal link anchor text between each cluster and the pillar, and content priority scores based on search volume and competition...
contenttopic-clusterarchitecture
GEO v1.0

Topical Authority GEO Scorer

Scores a site's topical authority depth as perceived by generative AI engines for a given subject area.

Evaluate {domain}'s content coverage, entity density, and citation footprint for the topic area '{topic}'. Score topical authority across five dimensions: breadth, depth, recency, E-E-A-T signals, and cross-LLM citation rate. Output a score card with improvement levers for each dimension...
geotopical-authoritye-e-a-t
Ranking v1.0

Video SERP Opportunity Finder

Identifies queries in a niche where video carousels appear and maps content gaps for YouTube/video SEO.

Scan the SERPs for the keyword set {keywords} and identify all queries triggering a video carousel or video rich result. For each, note the dominant video source, typical video length and format, and whether {domain} has competing video content. Output a video content gap report...
rankingvideoserp
Technical v1.0

XML Sitemap Architecture Spec

Specifies a multi-sitemap index architecture with priority signals and change-frequency logic.

Design a sitemap architecture for {domain} with the following page types: {page_types}. Specify: sitemap index structure, individual sitemap segmentation logic, which URLs to include/exclude, recommended changefreq and priority values per page type, and image/video sitemap extensions where applicable...
technicalsitemaparchitecture
GEO v1.0

AEO Topical Depth Scorer

Scores a page's answer-engine optimisation depth against the top LLM-cited competitors.

Compare the content of {target_url} against the top 5 sources cited by LLMs for the query {target_query}. Score {target_url} across: answer directness (0–20), entity coverage (0–20), factual density (0–20), structured formatting (0–20), and citation-worthy claims (0–20). Provide a gap analysis and a prioritised list of improvements...
geoaeotopical-authority
GEO v1.0

AI Mode Content Visibility Plan

Creates a structured plan to increase {domain} visibility within Google AI Mode results.

Analyse the following set of AI Mode responses for queries in {niche}: {ai_mode_response_samples}. Identify the top 10 content formats, entity types, and structural patterns appearing in AI Mode. Map each pattern against existing {domain} content and produce a 90-day content and optimisation plan to increase AI Mode appearances...
geoai-modevisibility
GEO v1.0

AI Overview Entity Gap Finder

Identifies entity associations missing from your content that AI Overviews rely on for answers.

For the query set {query_list}, retrieve the current Google AI Overview text for each query and extract every named entity (brand, person, concept, place) mentioned. Compare these entities against the content of {target_url}. List entities present in AI Overviews but absent from the target page, and recommend where to naturally incorporate each one...
geoai-overviewentity
Content v1.0

Anchor Text Gap Planner

Audits anchor text diversity for priority pages and recommends a natural variation plan.

Using the internal link anchor text export ({anchor_csv}) for {domain}, analyse the anchor text distribution for each of the following priority pages: {priority_pages}. Flag pages where exact-match anchor text exceeds 40% of total anchors, where generic anchors (click here, read more) exceed 20%, or where the primary target keyword is entirely absent. Output a recommended anchor text variation plan...
contentanchor-textinternal-links
Ranking v1.0

Branded Query SERP Ownership Audit

Analyses branded SERP real estate and identifies non-owned results diluting brand control.

For the branded query set {branded_queries} for {brand_name}, document every result in positions 1–10: URL, result type (sitelink, knowledge panel, review site, social, news, etc.), and whether it is owned or third-party. Identify third-party results with negative or off-message content and recommend defensive content or schema actions to displace them...
rankingbranded-serpreputation
Audit v1.0

Broken Link Impact Triage

Prioritises broken internal and external links by PageRank proximity and crawl frequency.

Given the broken link report ({broken_links_csv}) and internal link graph ({link_graph_csv}), rank each broken link by: (1) number of internal links the source page receives, (2) crawl frequency of the source page in the last 30 days, and (3) whether the broken destination was previously indexed. Output a fix-priority queue with recommended redirect or replacement targets...
auditbroken-linkslink-equity
Audit v1.0

Canonical Tag Conflict Audit

Detects conflicting or self-referencing canonical tags that undermine indexing signals.

Given the crawl data below ({canonical_export_csv}), flag every page where: (1) the canonical points to a URL that itself has a different canonical (chained canonicals), (2) the canonical points to a non-indexable URL, (3) the canonical is missing entirely, or (4) pagination pages incorrectly self-canonicalise. Provide corrected canonical values for each...
auditcanonicalindexing
Technical v1.0

CDN SEO Configuration Spec

Specifies CDN caching, header, and routing rules optimised for crawlability and page speed.

Write a CDN configuration spec for {cdn_provider} on {domain} that optimises for SEO. Include: cache TTL rules per content type (HTML: {html_ttl}, static assets: {asset_ttl}), cache-busting strategy for content updates, Vary header configuration for mobile/desktop serving, redirect handling at the edge to prevent redirect chains, and bot-detection passthrough rules to ensure Googlebot always receives a 200 response...
technicalcdnperformance
GEO v1.0

Citation Context Signal Brief

Identifies the exact sentence-level context signals that trigger LLM citations for a topic.

Collect LLM-generated answers for the query set {query_list} from ChatGPT and Perplexity. For each citation, extract the exact sentence in the source document that was paraphrased or quoted. Identify recurring linguistic patterns (e.g., stat-first sentences, numbered lists, definition structures) and produce a citation-trigger pattern guide for {topic}...
geocitationcontent-signals
GEO v1.0

Claude Citation Pattern Analysis

Reverse-engineers which content signals make Anthropic Claude prefer specific sources.

Submit each query in {query_list} to Claude and record the full response including any sources mentioned or recommended. Analyse: (1) what content format each cited source uses, (2) average word count and structure, (3) domain authority tier, (4) recency of cited content. Produce a pattern report of the top 5 content signals Claude favours...
geoclaudecitation
Ranking v1.0

Cluster Opportunity Size Scorer

Sizes and prioritises topic clusters by total addressable search volume and competition.

Given the keyword list {keyword_csv} with search volume and keyword difficulty data, group keywords into topical clusters using semantic similarity. For each cluster, calculate: total monthly search volume, average keyword difficulty, estimated traffic at position 3, and current {domain} coverage percentage. Rank clusters by opportunity score (volume × (1 − difficulty) × coverage_gap) and output a prioritised roadmap...
rankingclustersopportunity
Content v1.0

Content Brief Competitor Gap

Builds a content brief by identifying subtopics your competitors cover that you don't.

Analyse the top 5 ranking pages for '{target_keyword}': {competitor_urls}. Extract every H2/H3 heading, key subtopic, and semantic entity covered. Compare against {target_url}. List all subtopics present in 3 or more competitor pages but absent from {target_url}. Structure these into a prioritised content addition brief with recommended placement and word count per section...
contentcontent-gapcompetitor
Content v1.0

Content Decay Diagnosis Report

Diagnoses the root cause of traffic decline on ageing pages and prescribes targeted fixes.

For the pages in {decaying_pages_list}, pull organic traffic and ranking position data for the last 24 months. For each page, identify the decay onset date, correlate it with algorithm updates, SERP feature changes, or competitor content improvements, and classify the decay type as: freshness-related, relevance-related, or authority-related. Output a diagnosis and tailored fix prescription per page...
contentcontent-decaydiagnosis
Content v1.0

Content Refresh Priority Scorer

Scores existing content by decay risk and refresh ROI to build a prioritised update queue.

Using the content inventory {content_inventory_csv} with last-modified date, organic sessions (last 12 months vs prior 12 months), ranking position trend, and word count, score each page on: traffic decay rate, ranking position drop, content age, and SERP freshness signals. Output a refresh priority queue sorted by estimated traffic recovery potential...
contentcontent-refreshprioritization
Content v1.0

E-E-A-T Gap Brief

Identifies missing experience, expertise, authority, and trust signals on a target page.

Evaluate {target_url} for E-E-A-T signals against Google's Quality Rater Guidelines. Audit: author biography and credentials, first-hand experience indicators, cited sources and their authority, trust signals (reviews, awards, certifications), and About/Contact page completeness. Score each dimension 0–10 and provide specific content additions to close each gap...
contente-e-a-tquality
Technical v1.0

Edge SEO Cloudflare Worker Spec

Writes a Cloudflare Worker script to inject or modify SEO-critical headers and tags at the edge.

Write a Cloudflare Worker script for {domain} that: (1) injects canonical tags dynamically for paginated URLs matching the pattern {url_pattern}, (2) adds X-Robots-Tag: noindex headers for URL paths in {noindex_paths}, (3) sets Cache-Control headers for static assets in {asset_paths}, and (4) rewrites {old_url_pattern} to {new_url_pattern} with a 301 redirect. Include error-handling logic...
technicaledge-seocloudflare
Audit v1.0

Faceted Navigation Crawl Audit

Reviews faceted URL parameters to prevent crawl waste and duplicate content from filters.

Analyse the following list of faceted navigation URLs crawled on {domain}: {faceted_url_sample}. For each parameter type (e.g., color, size, sort), classify it as: index-and-crawl, noindex-and-crawl, or block-in-robots.txt. Justify each decision based on unique content value, search demand, and crawl budget impact...
auditfaceted-navcrawl-budget
Content v1.0

FAQ Schema Block Generator

Generates PAA-aligned FAQ content blocks with embedded FAQPage JSON-LD for a target page.

For the page topic '{page_topic}' on {target_url}, generate 8 FAQ question-and-answer pairs aligned with People Also Ask queries for '{primary_keyword}'. Each answer must be 40–60 words, factually accurate, and directly answer the question. Also output a complete FAQPage JSON-LD block ready to embed in the page <head>...
contentfaqschema
Ranking v1.0

Featured Snippet Content Rewriter

Rewrites a target content block to match the format and length Google favours for snippets.

The following URL ({target_url}) ranks in positions 2–5 for the query '{target_query}' but does not hold the featured snippet. The current snippet holder is {competitor_url}. Rewrite the answer block of {target_url} to: open with a direct definition or answer, use {snippet_format} format (paragraph/list/table), stay within 40–60 words, and include the exact query phrasing...
rankingfeatured-snippetserp
GEO v1.0

Generative SERP Source Authority Model

Models which authority signals correlate with selection as a generative SERP source.

For the topic cluster {topic_cluster}, collect the sources cited in AI Overviews across 20+ related queries. For each cited domain, record: referring domain count, topical authority score, average content word count, schema types present, and publication recency. Run a correlation analysis and output the top authority signals ranked by citation likelihood...
geoauthoritygenerative-serp
GEO v1.0

GEO Content Brief Optimizer

Builds a GEO-optimised content brief engineered to earn citations across AI answer engines.

Create a GEO-optimised content brief for the topic {topic} targeting AI answer engines. The brief must specify: target queries, required named entities, recommended content structure (H-tags, lists, tables), minimum factual claim density per 100 words, schema markup types, and recency signals needed. Base recommendations on citation patterns from {competitor_cited_sources}...
geocontent-briefcitation
Audit v1.0

Hreflang Signal Conflict Finder

Cross-checks hreflang annotations for missing return tags, wrong locales, and broken URLs.

Review the hreflang implementation data below ({hreflang_export_csv}) for {domain}. Identify: (1) any hreflang tag missing a reciprocal return tag, (2) incorrect ISO 639-1 language or ISO 3166-1 region codes, (3) hreflang URLs returning non-200 status codes, and (4) x-default tags pointing to incorrect fallback pages. Output a corrected tag set...
audithreflanginternational
Technical v1.0

Hreflang Tag Configuration Builder

Generates a complete, validated hreflang tag set for a multi-regional or multilingual site.

Given the following site URL structure and regional targeting data ({site_map_csv}), generate the complete set of hreflang link elements for each page variant. Include: correct ISO 639-1 language and ISO 3166-1 country codes, x-default designation for {default_region}, self-referencing hreflang on each variant, and HTTP header implementation format for non-HTML assets...
technicalhreflanginternational
Audit v1.0

Image SEO Metadata Sweep

Audits image alt text, file names, dimensions, and format compliance across a page set.

Using the image inventory export below ({image_audit_csv}), flag every image that: (1) has a missing or empty alt attribute, (2) uses a non-descriptive file name (e.g., IMG_001.jpg), (3) is served in JPEG or PNG where WebP/AVIF would reduce size by >20%, or (4) lacks width and height attributes. Provide corrected values for each...
auditimage-seocore-web-vitals
Ranking v1.0

Image SERP Visibility Optimizer

Diagnoses why images from {domain} under-perform in Google Images and proposes fixes.

Audit the image SERP for the query set {image_queries}. For each query, record the top 10 ranking images and their source pages. Compare the alt text, file names, surrounding text context, page schema, and page authority against images from {domain} appearing below position 10. Identify the 3 most impactful optimisation levers and produce an action list...
rankingimage-serpvisibility
Technical v1.0

INP LCP CLS Fix Playbook

Generates a per-URL fix playbook for INP, LCP, and CLS failures from CrUX or lab data.

Using the Core Web Vitals field data export ({cwv_export_csv}) for {domain}, identify all URLs failing INP (>200ms), LCP (>2.5s), or CLS (>0.1) thresholds. For each failing URL, diagnose the most likely root cause based on the metric value, page type, and resource waterfall if provided. Output a fix playbook per URL with code-level recommendations and expected metric improvement...
technicalcore-web-vitalsperformance
Audit v1.0

Internal Link Equity Audit

Scores internal link distribution across the site and highlights under-linked priority pages.

Using the internal link graph export ({internal_links_csv}) and the list of priority pages ({priority_pages}), calculate the number of unique internal links each priority page receives. Identify priority pages in the bottom 25th percentile, list the top 5 relevant pages that should link to each, and recommend anchor text for each new link...
auditinternal-linkslink-equity
Technical v1.0

JSON-LD Validation Repair Brief

Diagnoses JSON-LD structured data errors from Rich Results Test output and outputs fixed code.

Review the following Rich Results Test / Schema.org validator output for {target_url}: {validation_errors_json}. For each error and warning, explain the cause, provide the corrected JSON-LD property or value, and output the complete fixed JSON-LD block. Flag any schema type where the current implementation is ineligible for a rich result and recommend the minimum required properties...
technicaljson-ldschema
Ranking v1.0

Keyword Cannibalization Map

Detects pages competing for the same keyword and recommends consolidation or differentiation.

Using the ranking data export {ranking_csv}, identify all keyword-URL pairs where two or more {domain} URLs rank in the top 50 for the same keyword. For each conflict, classify the resolution as: consolidate (merge pages), differentiate (adjust on-page intent signals), or canonicalise. Provide specific recommended actions and an expected ranking outcome for each...
rankingcannibalizationkeywords
Ranking v1.0

Knowledge Panel Signal Optimizer

Audits on-site and off-site signals needed to trigger or enhance a Google Knowledge Panel.

Evaluate {entity_name} ({entity_type}: person/brand/organisation) for Knowledge Panel eligibility. Audit: Wikipedia/Wikidata presence, Google Business Profile completeness, sameAs schema annotations on {domain}, consistent NAP/entity data across top-20 reference sources, and co-citation patterns. Output a prioritised signal-building plan with estimated timeline...
rankingknowledge-panelentity
GEO v1.0

LLM Brand Mention Diagnostic

Tests how {brand} is mentioned, described, or omitted across multiple LLM platforms.

Run the following brand-probe queries ({brand_queries}) across ChatGPT, Claude, Gemini, and Perplexity. For each platform, record: (1) whether {brand} is mentioned unprompted, (2) the exact description used, (3) whether competitors are mentioned alongside it, and (4) any factual inaccuracies. Output a brand-perception gap report per model...
geobrand-mentionsmulti-llm
GEO v1.0

LLM Source Drift Monitor

Tracks week-over-week shifts in which sources LLMs prefer for a defined query set.

Using the historical LLM citation snapshots for {query_set} taken on {date_range}, identify any sources that gained or lost citation frequency by more than 20% between snapshots. For each shifted source, correlate the change with known content updates, new competitor pages, or model update dates. Output a drift report with recommended defensive actions...
geollmmonitoring
Ranking v1.0

Local Pack Gap Analyzer

Compares your GBP and local signals against local pack leaders to identify ranking gaps.

For the local queries {local_queries} in the target location {location}, identify the 3 businesses consistently appearing in the local pack. For each competitor, document: review count and average rating, GBP category taxonomy, citation count in top local directories, landing page on-page signals, and distance proxy. Compare each signal against {business_name} and output a prioritised gap-closing plan...
rankinglocal-packgbp
Audit v1.0

Log File Crawl Pattern Audit

Analyses server log data to surface crawl waste, bot behaviour, and missed high-value pages.

Using the server log export below ({log_file_csv}), identify: (1) the top 20 URLs Googlebot crawled most frequently, (2) high-value pages crawled fewer than twice in 30 days, (3) non-canonical or redirect URLs consuming crawl budget, and (4) any 4xx/5xx responses served to Googlebot. Output a prioritised fix list...
auditlog-filecrawl-budget
Audit v1.0

Mobile-First Rendering Check

Verifies that mobile-rendered HTML contains the same critical content as the desktop version.

Compare the desktop-rendered HTML and mobile-rendered HTML for the following URLs ({url_list}). Identify any content blocks, structured data, internal links, or meta tags present in the desktop render but absent in the mobile render. Flag each discrepancy with its SEO impact level (high/medium/low) and suggest a fix...
auditmobile-firstrendering
Audit v1.0

Orphan Page Detection Sweep

Identifies pages with no internal links pointing to them so they can be re-connected or removed.

Given the following list of all crawled URLs and all internal links found on the site: {crawl_export_csv}, identify every URL that receives zero internal links from other pages. For each orphan page, classify it as: keep-and-link, consolidate, or remove, and suggest the single best page to link from...
auditinternal-linkscrawl
Ranking v1.0

People Also Ask Expansion Map

Mines PAA boxes for a seed keyword and maps questions to content gaps.

For the seed keyword '{seed_keyword}', extract all People Also Ask questions visible in Google SERP across at least 3 levels of expansion. Cluster the questions by sub-topic, identify which clusters have no corresponding content on {domain}, and output a prioritised content gap map with recommended page type (FAQ, article, or landing page) for each cluster...
rankingpaacontent-gaps
GEO v1.0

Perplexity Citation Gap Hunter

Finds content and structural gaps preventing your pages from being cited in Perplexity answers.

Query Perplexity.ai with each of the following prompts: {query_list}. For each response, record every cited source URL and the sentence context surrounding the citation. Compare cited sources against {domain} pages. Identify the structural and content patterns (e.g., direct answer format, data tables, recency) present in cited pages but absent on {domain}...
geoperplexitycitation
Technical v1.0

Prerendering Eligibility Spec

Determines which pages qualify for prerendering and writes the configuration rules to enable it.

For {domain}, evaluate which URL patterns in {url_patterns} are eligible for prerendering based on: (1) no user-specific dynamic content, (2) no authentication gates, (3) stable content with low update frequency, (4) no infinite scroll or heavy JS interactions required for core content. Output a prerender eligibility classification per pattern and generate the corresponding prerender configuration rules for {prerender_service}...
technicalprerenderingrendering
Content v1.0

Programmatic SEO Template Spec

Designs a scalable programmatic content template with dynamic variables and quality guardrails.

Design a programmatic SEO content template for the page type '{page_type}' targeting '{query_pattern}'. Define: all dynamic {variables}, static content sections that establish E-E-A-T, uniqueness mechanisms to avoid thin content, required schema markup, internal linking logic for hub pages, and a quality-check rubric with pass/fail thresholds for each generated page...
contentprogrammatic-seotemplate
Audit v1.0

Redirect Chain Depth Mapper

Maps multi-hop redirect chains and flags those exceeding recommended depth thresholds.

Review the following redirect map export ({redirect_csv}) and identify all chains with 2 or more hops. For each chain, list every hop URL, the final destination, the total hop count, and whether the chain mixes HTTP/HTTPS or www/non-www. Output a recommended collapsed redirect for each chain...
auditredirectstechnical
Technical v1.0

Robots.txt Directive Architect

Builds an optimised robots.txt file that protects crawl budget without blocking key assets.

Create a production-ready robots.txt file for {domain} with the following requirements: (1) block crawling of {disallow_paths}, (2) allow crawling of all CSS/JS required for rendering, (3) include sitemap directive pointing to {sitemap_url}, (4) set crawl-delay for {non-google_bots} to {crawl_delay_seconds} seconds, and (5) explicitly allow Googlebot-Image for product images in {image_path}...
technicalrobots-txtcrawl-budget
Content v1.0

Schema-Rich Article Drafter

Drafts a full article structured to maximise schema eligibility and rich-result appearance.

Write a {word_count}-word article on '{topic}' for {target_url}. Structure the article to support: Article schema (headline, author, datePublished), FAQPage schema for the FAQ section, HowTo schema if steps are included, and BreadcrumbList schema. Include at least 3 expert citations, a direct-answer lede paragraph for featured snippet targeting, and a structured data specification block at the end...
contentschemarich-results
Technical v1.0

Security Header SEO Impact Check

Audits HTTP security headers for configurations that may inadvertently harm SEO or rendering.

Review the HTTP response headers for {domain} ({headers_export}). Identify any security header configurations that may negatively impact SEO: (1) Content-Security-Policy rules blocking Googlebot from loading CSS/JS, (2) X-Frame-Options preventing embedding in featured snippets, (3) missing or misconfigured HSTS causing redirect chains, (4) Referrer-Policy stripping analytics attribution. Output a remediation spec...
technicalsecurity-headersrendering
Ranking v1.0

SERP Intent Mismatch Detector

Identifies pages optimised for the wrong intent type relative to what the SERP actually rewards.

For each URL-keyword pair in {page_keyword_map}, retrieve the current Google SERP for the target keyword and classify dominant intent as: informational, navigational, commercial, or transactional. Compare this to the intent of the current page. Flag all mismatches and recommend a content-type change or new page creation for each...
rankingintentserp
Technical v1.0

Server-Side Rendering Decision Audit

Evaluates whether SSR, CSR, or hybrid rendering best serves SEO for a given page type.

For each page type in {page_types} on {domain}, evaluate the current rendering approach against SEO requirements. Assess: time-to-first-byte, content visibility in raw HTML response, Googlebot render vs HTTP response diff, Core Web Vitals scores, and JS execution dependency for critical content. Recommend SSR, CSR, SSG, or ISR for each page type with justification...
technicalrenderingssr
Content v1.0

Title Meta Batch Rewriter

Rewrites underperforming title tags and meta descriptions in bulk using CTR-optimisation rules.

For each page in the following list ({page_data_csv} with current title, meta description, target keyword, and average CTR), rewrite the title tag and meta description. Rules: title must be 50–60 characters, lead with the primary keyword, include a power word or number where natural; meta description must be 140–155 characters, include a clear CTA, and mirror SERP intent. Flag any with CTR below {ctr_threshold}% as high-priority...
contenttitle-tagsctr
Content v1.0

Topic Cluster Content Brief

Generates a full pillar-and-cluster content brief for a target topic with internal linking logic.

Create a complete topic cluster plan for the pillar topic '{pillar_topic}'. Include: one pillar page outline, 8–12 cluster page titles with target keywords and search intent, recommended word count per page, internal link flow between pillar and clusters, and schema type per page. Base cluster topics on PAA data, related searches, and keyword gaps from {competitor_domains}...
contenttopic-clustercontent-brief
Ranking v1.0

Video SERP Ranking Audit

Audits which queries trigger video carousels and scores {domain}'s video content eligibility.

For the query set {query_list}, identify which SERPs include a video carousel or inline video result. For queries where {domain} has relevant video content but does not appear, audit: VideoObject schema presence, video sitemap inclusion, thumbnail quality, title keyword alignment, and page load speed. Output a prioritised optimisation checklist per video URL...
rankingvideo-serpschema
Technical v1.0

XML Sitemap Priority Engineer

Designs a segmented XML sitemap architecture with correct priority and changefreq values.

Design an XML sitemap architecture for {domain} with {total_pages} indexable pages. Define: sitemap index file structure, individual sitemap files segmented by content type ({page_types}), priority values (0.1–1.0) based on page tier, changefreq values based on actual update cadence, and exclusion rules for noindex and canonicalized-away pages. Output a ready-to-submit sitemap index XML...
technicalsitemapcrawl
GEO v1.0

AI Mode Query Intent Optimizer

Optimizes existing content to better satisfy the multi-step reasoning patterns of Google AI Mode queries.

Analyze the following page content from {page_url} against the AI Mode query pattern '{target_query}'. Identify where the content fails to address follow-up intent layers, restructure the content outline to pre-answer likely sub-questions, and recommend schema additions that improve AI Mode answer eligibility...
geoai-modequery-intent
GEO v1.0

AI Overview Passage Eligibility Scorer

Scores individual content passages for likelihood of selection in Google AI Overview responses.

Evaluate the following passages from {page_url} against Google AI Overview selection criteria. For each passage, score it on directness, factual density, source authority signals, and formatting clarity (0–10 each), then recommend specific rewrites to increase eligibility...
geoai-overviewpassage-scoring
GEO v1.0

Brand Mention Sentiment Diagnostic

Diagnoses how LLMs characterize a brand in generative responses and flags negative framings.

Query ChatGPT, Claude, and Perplexity with '{brand_name} review', '{brand_name} alternatives', and '{brand_name} problems'. Extract and compare how each model characterizes the brand, flag any negative or inaccurate framings, and recommend content and entity reinforcement strategies to improve brand representation...
geobrand-mentionssentiment
Ranking v1.0

Branded Query Share of Voice

Measures branded SERP share of voice across owned and third-party results for brand protection.

For the branded query set {branded_query_list} associated with {brand_name}, analyze the current SERP composition. Calculate the percentage of page-1 results owned by {site_url} vs. third-party domains (review sites, directories, press). Flag any third-party results with negative sentiment and recommend a content and link strategy to reclaim SERP real estate...
rankingbrandedshare-of-voice
Technical v1.0

CDN Cache SEO Impact Audit

Audits CDN caching configuration for SEO issues including stale canonicals and blocked crawler access.

Audit the CDN caching configuration for {site_url} hosted on {cdn_provider}. Identify cache rules that may serve stale canonical tags, outdated meta robots directives, or incorrect hreflang values to Googlebot. Check whether crawler IP ranges are being rate-limited or blocked by CDN WAF rules. Output a CDN config patch spec...
technicalcdncaching
GEO v1.0

ChatGPT Brand Citation Forecast

Forecasts the probability of ChatGPT citing a brand based on training signal indicators.

Assess the following brand profile for {brand_name}: {brand_profile_data}. Estimate the likelihood of ChatGPT (GPT-4o) citing this brand in responses to {target_query_set} by evaluating Wikipedia presence, high-authority backlink profile, structured entity data, and co-citation patterns. Output a probability score with justification...
geochatgptbrand-citations
GEO v1.0

Claude Source Preference Drift Audit

Tracks shifts in Claude's citation preferences for a topic across model versions over time.

Compare Claude's cited sources for the query set {query_list} across model versions {version_a} and {version_b}. Identify domains that gained or lost citations between versions, hypothesize content or authority signal changes that drove the drift, and recommend actions for {site_url} to maintain citation stability...
geoclaudesource-drift
Ranking v1.0

Competitor SERP Gap Analysis Map

Identifies keywords where competitors rank in top 10 but the target site is absent or page 2+.

Using the following keyword ranking exports for {site_url} and competitors {competitor_list}: {ranking_data}, identify all keywords where at least two competitors rank in positions 1–10 but {site_url} ranks below position 20 or is absent. Cluster these gap keywords by topic and estimate combined monthly search volume per cluster...
rankingcompetitor-gapkeyword-research
Content v1.0

Content Brief Entity Enrichment

Enriches a standard content brief with named entities and semantic concepts to boost topical depth.

Take the following draft content brief for the topic '{target_topic}': {draft_brief}. Enrich it with a prioritized list of named entities (people, organizations, places, concepts) that top-ranking pages include but the brief omits. For each entity, explain its semantic relevance and suggest where in the outline to naturally integrate it...
contententitiesbrief
Content v1.0

Content Decay Traffic Loss Diagnosis

Diagnoses the root causes of traffic decay on a specific page and prescribes targeted recovery actions.

Diagnose the traffic decay for {page_url}, which has lost {traffic_loss_percent}% of organic clicks over the past {time_period}. Analyze ranking position changes, SERP feature shifts, competitor content improvements, content freshness, and index coverage signals. Produce a root-cause summary and a step-by-step recovery action plan...
contentcontent-decayrecovery
Content v1.0

Content Outline SERP Gap Builder

Builds a content outline by identifying heading and subtopic gaps across the top 10 SERP results.

Analyze the headings and subheadings of the top 10 ranking pages for '{target_keyword}'. Identify H2/H3 topics covered by 3 or more competitors that are absent from {existing_page_url}'s current outline. Produce an enriched outline that incorporates all high-frequency competitor subtopics plus unique angles to differentiate the content...
contentoutlineserp-gap
Content v1.0

Content Refresh Impact Prioritizer

Ranks existing content pages by refresh ROI using traffic decay, ranking potential, and effort scores.

Analyze the following content inventory for {site_url}: {content_inventory_csv}. For each page, calculate a refresh priority score based on: traffic decline over 6 months, current position for primary keyword (positions 5–20 score highest), content age, and estimated refresh effort. Output a ranked refresh queue with recommended action per page (update, expand, merge, or retire)...
contentrefreshprioritization
Audit v1.0

Core Web Vitals Field Data Triage

Diagnoses CrUX field data failures per page template and maps fixes to responsible teams.

Review the following CrUX field data export for {site_url}: {crux_data}. Group failing URLs by page template, identify the dominant failure metric (LCP, INP, or CLS) per template, and produce a fix matrix that maps each issue to the responsible team (frontend, backend, or CMS)...
auditcore-web-vitalscrux
Audit v1.0

Duplicate Content Canonical Sweep

Finds near-duplicate page clusters and validates canonical signal consistency across them.

Analyze the following crawl export containing page titles, meta descriptions, and word counts for {site_url}: {crawl_export}. Cluster URLs with high textual similarity, verify whether canonical tags are correctly pointing to the intended canonical within each cluster, and flag any canonicals pointing to noindexed or redirected URLs...
auditduplicate-contentcanonical
Technical v1.0

Edge SEO Cloudflare Worker Builder

Writes a Cloudflare Worker script to inject or modify SEO-critical HTTP headers and HTML elements at the edge.

Write a Cloudflare Worker script for {site_url} that: (1) injects canonical tags on URLs matching {url_pattern}, (2) adds hreflang headers for {locale_list}, (3) sets X-Robots-Tag: noindex on URLs matching {noindex_pattern}, and (4) returns a 301 redirect for the legacy URL patterns in {redirect_map}. Include error handling and performance optimizations...
technicaledge-seocloudflare
Content v1.0

E-E-A-T Author Credibility Scorecard

Scores a content author's on-page E-E-A-T signals and recommends improvements to author credibility.

Evaluate the E-E-A-T author signals for {author_name} on {site_url}. Audit the author bio page, byline consistency, external credential mentions, linked professional profiles, and first-hand experience signals in their published content. Score each dimension (0–10) and produce a remediation checklist to strengthen author authority...
contente-e-a-tauthor-authority
GEO v1.0

Entity Association Strength Mapper

Maps the semantic strength of entity associations between a brand and its target topic concepts.

Analyze how strongly {brand_name} is associated with the following target entities and concepts: {entity_list}. Use co-occurrence signals from Knowledge Graph data, Wikipedia references, and high-authority content to score each association (0–100) and recommend content and PR actions to strengthen weak associations...
geoentityknowledge-graph
Audit v1.0

Faceted Navigation Crawl Waste Audit

Evaluates faceted URL parameter combinations for crawl waste and duplicate content risk.

Review the following list of faceted navigation URLs crawled on {site_url}: {faceted_url_sample}. Classify each parameter combination as indexable, noindexable, or crawl-blocked, estimate the total crawl budget consumed by low-value facet URLs, and recommend a parameter handling strategy using robots.txt, rel=canonical, or URL parameter tools...
auditfaceted-navcrawl-budget
Content v1.0

FAQ Rich Result Content Generator

Generates FAQ question-answer pairs optimized for Google FAQ rich results and PAA eligibility.

Generate 8 FAQ entries for the topic '{page_topic}' on {page_url}. Each question must mirror a high-volume PAA or search query pattern. Each answer must be 40–60 words, factually precise, and structured to win a PAA box. Output the content in both plain text and FAQPage JSON-LD schema format...
contentfaqrich-results
Ranking v1.0

Featured Snippet Format Optimizer

Rewrites content blocks into the exact format (paragraph, list, table) winning the target snippet.

Analyze the current featured snippet holder for the query '{target_query}'. Identify its format type (paragraph, ordered list, unordered list, or table), word count, and structural pattern. Now rewrite the relevant section of {page_url}'s content to match and improve upon that format while preserving the page's unique value...
rankingfeatured-snippetserp
GEO v1.0

GEO Topical Authority Gap Brief

Identifies topical coverage gaps preventing a site from building LLM-recognized authority in a niche.

Assess {site_url}'s current content coverage against the full topical map for {niche}. Identify subtopics and entities that LLMs associate with authoritative sources in this niche but that {site_url} has not covered. Output a prioritized content brief for each gap, ordered by LLM citation impact...
geotopical-authoritycontent-gap
Audit v1.0

Hreflang Conflict Signal Auditor

Detects missing return tags, locale mismatches, and canonical conflicts in hreflang implementations.

Audit the following hreflang implementation data exported from {site_url}: {hreflang_csv}. Flag all URLs missing reciprocal return tags, identify locale code errors (e.g., incorrect ISO 639-1 or region subtags), and surface any pages where the hreflang target conflicts with the canonical tag...
audithreflanginternational
Technical v1.0

Hreflang XML Sitemap Config Builder

Generates a correctly structured hreflang XML sitemap for international site configurations.

Generate a valid hreflang XML sitemap for {site_url} covering the following locale-URL mapping: {locale_url_mapping}. Ensure all xhtml:link entries are bidirectional (each locale links to all others including itself), use correct ISO language and region codes, and include x-default entries where specified. Output the full sitemap XML...
technicalhreflangsitemap
Ranking v1.0

Image SERP Structured Data Optimizer

Optimizes image pages with structured data and metadata to rank in Google Image SERP features.

Review the following image-heavy pages on {site_url}: {image_page_urls}. For each page, audit alt text quality, file naming conventions, surrounding text context, ImageObject schema completeness, and page load speed. Output a prioritized fix list to maximize visibility in Google Image Search and image-rich SERP features...
rankingimage-serpstructured-data
Technical v1.0

INP LCP CLS Element Root Cause

Traces INP, LCP, and CLS failures to specific DOM elements and third-party scripts with fix specs.

Using the following WebPageTest and Chrome DevTools trace data for {page_url}: {trace_data}, identify the specific DOM element causing the LCP delay, the interaction event triggering the highest INP, and the layout shift sources contributing to CLS. For each, specify the responsible code owner and a concrete fix with expected metric improvement...
technicalcore-web-vitalsperformance
Content v1.0

Internal Link Anchor Text Strategy

Designs an anchor text strategy for internal links that balances exact-match, partial-match, and branded anchors.

Analyze the current internal link anchor text distribution for {target_page_url} on {site_url}. Calculate the ratio of exact-match, partial-match, branded, and generic anchors. Benchmark against best practices and the anchor profiles of top-3 competitors. Output a revised anchor text strategy with specific recommended anchor variants for the next 20 internal links to add...
contentanchor-textinternal-links
Audit v1.0

Internal Link Equity Flow Audit

Maps internal link equity distribution to reveal over-linked and under-linked priority pages.

Using the crawl-derived internal link graph for {site_url} provided below, calculate the relative internal PageRank distribution across all URLs. Identify the top 20 pages receiving disproportionately low internal equity relative to their conversion or traffic value, and recommend specific linking actions...
auditinternal-linksequity
Audit v1.0

JavaScript Render Gap Detector

Compares raw HTML vs. rendered DOM to identify content invisible to Googlebot.

Compare the raw HTML source and the fully rendered DOM for the following URLs on {site_url}: {url_list}. Identify all content, links, and structured data elements present in the rendered DOM but absent from the raw HTML, and classify each gap by SEO impact (critical, moderate, low)...
auditjavascriptrendering
Ranking v1.0

Keyword Cannibalization Priority Fix

Prioritizes cannibalizing keyword pairs by traffic impact and recommends merge or differentiate actions.

Analyze the following cannibalization report for {site_url}: {cannibalization_data}. For each cannibalizing URL pair, calculate combined click loss vs. consolidation potential, classify the fix type (301 merge, canonical, content differentiation, or internal link consolidation), and rank all pairs by expected traffic recovery...
rankingcannibalizationconsolidation
Ranking v1.0

Knowledge Panel Entity Signal Builder

Identifies missing entity signals needed to trigger or enhance a brand's Google Knowledge Panel.

Audit the Knowledge Panel presence for {brand_name} in Google Search. Identify missing or incomplete signals (Wikidata entry, Wikipedia page, Google Business Profile, sameAs markup, authoritative mentions) and produce a prioritized action plan to trigger or enhance panel appearance for the query '{brand_query}'...
rankingknowledge-panelentities
GEO v1.0

LLM Source Authority Signal Model

Models which authority signals most influence LLM source selection for a given content niche.

For the niche {content_niche}, analyze the top 20 domains most frequently cited by LLMs in responses to {query_sample}. Identify the common authority signals they share (e.g., .edu/.gov links, Wikipedia citations, Wikidata entries, EEAT signals) and produce a weighted signal model {site_url} can use to prioritize its GEO investments...
geoauthorityllm-signals
Ranking v1.0

Local Pack Competitor Gap Audit

Compares a local business's GBP signals against local pack competitors to identify ranking gaps.

Compare the Google Business Profile signals of {business_name} against the top 3 local pack results for '{local_query}' in {location}. Analyze review count and recency, category selection, photo volume, Q&A completeness, and citation consistency. Output a gap matrix with prioritized action items...
rankinglocal-packgbp
Audit v1.0

Log File Bot Behavior Audit

Analyzes server log data to surface Googlebot crawl patterns, frequency, and wasted budget.

Given the following server log extract for {site_url}, identify Googlebot crawl frequency by URL path segment, flag URLs receiving disproportionate crawls relative to their SEO value, and highlight any 4xx/5xx responses served to the crawler: {log_sample}...
auditlog-filecrawl
GEO v1.0

Multi-LLM Citation Variance Report

Compares citation behavior across ChatGPT, Claude, Gemini, and Perplexity for the same query set.

Run the following query set: {query_list} through ChatGPT, Claude, Gemini, and Perplexity. Tabulate which sources each model cites, identify sources cited by 3 or more models (high-consensus citations), and flag queries where {site_url} is cited by none. Recommend content improvements to close citation gaps...
geomulti-llmcitation-variance
Audit v1.0

Orphan Page Link Gap Sweep

Identifies site pages receiving zero internal links and recommends reinsertion points.

Using the following crawl export for {site_url}, identify all URLs that appear in the sitemap or index but receive zero internal links. For each orphan page, suggest the three most contextually relevant existing pages from which to add an internal link, with recommended anchor text...
auditorphan-pagesinternal-links
Ranking v1.0

People Also Ask Intent Expansion

Mines PAA trees for a seed keyword to uncover secondary intent clusters and content opportunities.

Starting from the seed keyword '{seed_keyword}', map the full People Also Ask expansion tree to depth 3. Cluster the resulting questions by intent type (informational, navigational, commercial, transactional), identify which clusters {site_url} currently has no content targeting, and output a prioritized content opportunity list...
rankingpaaintent-clusters
GEO v1.0

Perplexity Citation Source Profile

Builds a citation source profile by analyzing which domains Perplexity consistently cites for a topic.

For the following set of Perplexity AI responses to queries about {topic}, extract all cited domains and URLs. Rank them by citation frequency, identify shared content patterns (format, depth, schema, authority signals), and produce a gap analysis showing what {site_url} must improve to compete for citations...
geoperplexitycitations
Technical v1.0

Prerender Eligibility Config Spec

Determines which pages qualify for prerendering and generates the configuration spec to implement it.

Evaluate the following page templates on {site_url} for prerender eligibility: {page_template_list}. For each template, assess JavaScript dependency complexity, dynamic content requirements, personalization needs, and crawl frequency. Output a prerender/SSG/SSR decision matrix and the corresponding framework configuration (Next.js/Nuxt/SvelteKit) for each template type...
technicalprerenderingrendering
Content v1.0

Programmatic SEO Content Schema Seeder

Generates scalable content templates and schema blueprints for programmatic page production.

Design a programmatic content template for {site_url} targeting the '{page_type}' page type (e.g., [City] + [Service]). Define the dynamic and static content blocks, specify the schema type and required properties for each block, write a reusable copy template with {variable} placeholders, and outline quality thresholds to prevent thin-content penalties...
contentprogrammaticschema
Technical v1.0

Redirect 301 Consolidation Spec

Produces a clean redirect map consolidating multi-hop chains into single-hop 301 redirects.

Using the following redirect chain data from {site_url}: {redirect_data}, generate a consolidated redirect map where every source URL points directly to its final destination in a single 301 hop. Flag any chains ending in 4xx errors for manual review, identify redirect loops, and output the final map in both .htaccess and Nginx rewrite rule formats...
technicalredirects301
Audit v1.0

Redirect Chain Impact Analyzer

Evaluates multi-hop redirect chains for PageRank dilution and crawl inefficiency.

Analyze the following list of redirect chains from {site_url}: {redirect_chain_csv}. For each chain longer than one hop, calculate estimated PageRank dilution, flag chains ending in a 4xx or loop, and output a remediation plan with consolidated 301 targets...
auditredirectspagerank
Technical v1.0

Robots.txt Crawl Directive Optimizer

Audits and rewrites robots.txt directives to protect crawl budget while preserving indexable content.

Review the following robots.txt file for {site_url}: {robots_txt_content}. Identify directives that are over-blocking indexable content, under-blocking crawl-wasting URL patterns (e.g., session IDs, filter combinations), or using deprecated syntax. Output a rewritten robots.txt with inline comments explaining each directive change...
technicalrobots-txtcrawl-budget
Technical v1.0

Schema Markup Coverage Generator

Generates complete JSON-LD schema markup for all applicable schema types on a given page.

Analyze the following page content from {page_url}: {page_content_excerpt}. Identify all applicable Schema.org types (e.g., Article, BreadcrumbList, FAQPage, HowTo, Product, Organization). Generate valid JSON-LD markup for each type, populated with the actual page data, and flag any required properties that are missing from the source content...
technicalschemajson-ld
Technical v1.0

Security Headers SEO Risk Spec

Audits HTTP security headers for configurations that could harm SEO crawlability or indexing.

Audit the HTTP response headers returned by {site_url} for the following security configurations: Content-Security-Policy (check for blocking of Googlebot's rendering resources), X-Frame-Options, Strict-Transport-Security, and Permissions-Policy. Identify any header values that restrict crawler access, block JavaScript/CSS rendering, or affect HTTPS signal strength. Output a header configuration spec...
technicalsecurity-headerscrawlability
Ranking v1.0

SERP Volatility Change Tracker

Detects ranking volatility patterns for a keyword set and correlates spikes with algorithm updates.

Analyze the 90-day ranking history for the following keyword set on {site_url}: {keyword_ranking_data}. Identify volatility spikes (±5 positions in 7 days), cross-reference spike dates against confirmed Google algorithm update dates, and classify each spike as likely algorithm-driven, competitor-driven, or content-driven...
rankingvolatilityalgorithm-updates
Technical v1.0

Server-Side Rendering SEO Config

Produces an SSR configuration spec ensuring critical SEO elements are rendered server-side.

Design an SSR configuration spec for a {framework} application at {site_url} to ensure Googlebot receives fully rendered HTML. Specify which page templates require SSR vs. static generation vs. client-side rendering, define the critical SEO elements (title, meta, canonical, structured data, body content) that must appear in the initial server response, and outline the hydration strategy...
technicalssrrendering
Ranking v1.0

Shopping SERP Feed Optimizer

Audits Google Shopping feed attributes to improve product visibility in Shopping SERP features.

Review the following Google Merchant Center feed excerpt for {site_url}: {feed_sample}. Identify missing or low-quality attributes (title structure, GTIN, product_type taxonomy, image quality, price accuracy), benchmark against top Shopping SERP competitors for '{product_category}', and output an attribute optimization plan...
rankingshopping-serpproduct-feed
Audit v1.0

Technical Site Audit Framework

Generates a structured technical SEO audit checklist tailored to a given site type and CMS.

You are a senior technical SEO auditor. Produce a comprehensive technical site audit checklist for {site_url} built on {cms}. Organize findings into priority tiers (critical, high, medium, low) and include the diagnostic method for each item...
audittechnicalchecklist
Content v1.0

Title Meta Description CTR Rewriter

Rewrites underperforming title tags and meta descriptions to improve click-through rate from SERPs.

The following pages on {site_url} have a CTR below {ctr_benchmark}% for their primary keyword: {low_ctr_pages}. For each page, analyze the current title and meta description against the top-3 SERP competitors. Rewrite both elements to improve emotional resonance, include the primary keyword naturally, and fit within 60 and 155 characters respectively...
contentctrmeta-tags
Content v1.0

Topic Cluster Hub-Spoke Planner

Designs a hub-and-spoke topic cluster with pillar and supporting page assignments for a target niche.

Design a complete hub-and-spoke content cluster for the pillar topic '{pillar_topic}' targeting {site_url}. Identify one pillar page, 8–12 supporting spoke pages, and 3–5 micro-topic pages per spoke. For each page, specify the primary keyword, target search intent, recommended word count, and internal linking relationships...
contenttopic-clusterarchitecture
Technical v1.0

XML Sitemap Health Engineer

Audits XML sitemap files for inclusion errors, priority misuse, and lastmod inaccuracies.

Audit the XML sitemap files at {sitemap_url}. Identify URLs included that return non-200 status codes, are noindexed, or are canonicalized to a different URL. Flag incorrect use of <priority> values and <lastmod> dates that don't reflect actual content changes. Output a clean sitemap spec and a list of URLs to add or remove...
technicalsitemapindexing
GEO v1.0

AI Mode SERP Content Fit Scorer

Scores existing content pages for structural fit with Google AI Mode generative result formats.

Act as an AI Mode SERP optimization specialist. Review the following {n} pages from {domain} and score each for AI Mode content fit across these criteria: direct answer density, list/table format usage, heading question-match rate, and entity completeness. Provide a ranked list of pages most likely to surface in AI Mode with specific improvement notes...
geoai-modecontent-fit
GEO v1.0

AI Overview Passage Retrieval Scorer

Scores individual content passages for likelihood of retrieval in Google AI Overview responses.

You are a GEO analyst specializing in AI Overview optimization. Review the following content passages from {url} and score each on a 1-10 scale for AI Overview retrieval likelihood, evaluating criteria: semantic completeness, factual precision, citation-readiness, and passage self-containment. Provide a score card and rewrite suggestions for the bottom-scoring passages...
geoai-overviewpassage-scoring
Content v1.0

Anchor Text Diversity Planner

Builds a varied anchor text distribution plan for internal links pointing to a priority page.

You are an anchor text strategy expert. For the target page {target_url} on {domain}, which targets the primary keyword {keyword}, create a diversified anchor text plan for {n} internal links. Include exact-match, partial-match, branded, generic, and long-tail anchor variants in a distribution that avoids over-optimization. For each variant, suggest three source pages and placement context...
contentanchor-textinternal-links
GEO v1.0

Brand Citation Sentiment Profiler

Analyzes the sentiment context surrounding brand mentions in LLM-generated answers.

You are a GEO brand analyst. Collect LLM-generated answers mentioning {brand} from ChatGPT, Claude, and Perplexity for the query set {query_list}. For each mention, classify the surrounding sentiment (positive, neutral, negative) and the context type (recommendation, comparison, caveat, disclaimer). Summarize patterns and recommend content or PR actions to shift negative contexts...
geobrandsentiment
Technical v1.0

CDN Cache-Control SEO Header Spec

Specifies Cache-Control and CDN header rules optimized for SEO crawlability and page speed.

Act as a CDN SEO configuration specialist. For {domain} using {cdn_provider}, define Cache-Control header rules for each of the following resource types: {resource_type_list}. Optimize TTL values to balance freshness for Googlebot re-crawl with performance for real users. Include Vary header configuration, stale-while-revalidate settings, and CDN purge trigger recommendations for content updates...
technicalcdncache-control
GEO v1.0

ChatGPT Entity Citation Readiness

Evaluates how well a brand's entity signals position it for ChatGPT citation in Browse mode.

You are a generative AI citation analyst. Assess the entity profile for {brand} across the following dimensions: Wikipedia/Wikidata presence, knowledge graph attributes, third-party reference quality, and structured data consistency. Score each dimension and provide a prioritized list of actions to improve ChatGPT Browse-mode citation probability...
geochatgptentity
Technical v1.0

Cloudflare Worker SEO Redirect Spec

Writes a Cloudflare Worker script to handle SEO-critical redirects at the edge without origin latency.

You are an edge SEO engineer. Write a Cloudflare Worker script that implements the following redirect rules for {domain}: {redirect_rules_list}. The script must serve 301 responses for permanent redirects, 302 for temporary, preserve query strings where specified, and log redirect events to a KV store for monitoring. Include inline comments explaining each rule and a test case block...
technicaledge-seocloudflare
Ranking v1.0

Competitor Content SERP Gap Map

Maps keyword gaps where competitors rank but the target domain has no indexable content.

Act as a competitive SEO analyst. Using the keyword ranking exports for {domain} and competitors {competitor_list}, identify all keywords where at least two competitors rank in the top 10 but {domain} has no page ranking in the top 50. Group gaps by topic theme, estimate traffic opportunity, and prioritize by competition difficulty...
rankingcompetitor-gapkeywords
Content v1.0

Content Brief SERP Intent Alignment

Generates a content brief precisely aligned to the dominant intent signals in the target SERP.

You are a content strategist specializing in SERP alignment. For the target keyword {keyword}, analyze the top 10 ranking pages and identify dominant content format, average word count, heading structure patterns, and featured snippet formats present. Produce a detailed content brief that mirrors the winning SERP signals while differentiating {domain}'s angle through {unique_value_proposition}...
contentcontent-briefintent
Content v1.0

Content Gap Topic Cluster Finder

Identifies content topics within a cluster that are absent from a domain's existing content.

You are a content gap analyst. For the topic cluster centered on {pillar_topic}, map all sub-topics and supporting keyword themes that should be covered to establish topical authority. Cross-reference this map against the existing content inventory of {domain}: {content_inventory_list}. Identify every missing sub-topic, classify by search volume tier, and prioritize by topical authority impact...
contentcontent-gaptopic-cluster
Content v1.0

Content Outline E-E-A-T Signals

Structures a content outline with explicit E-E-A-T signal placements baked into every section.

Act as an E-E-A-T content architect. For the topic {topic} targeting {audience}, create a full content outline where each heading is accompanied by: the experience/expertise signal to include, the authoritative source to cite, and the trust element to embed (author credential, data point, methodology note). Ensure the outline reflects Google's quality evaluator guidelines...
contente-e-a-toutline
Content v1.0

Content Refresh Traffic Prioritizer

Scores decaying content pages by refresh ROI potential using traffic and ranking trend data.

You are a content refresh strategist. Using the GSC performance data below for {domain} covering the last 12 months, identify pages with declining impressions and clicks where the URL still holds rankings in positions 5–20. Score each by refresh ROI (traffic recovery potential × effort estimate) and output a prioritized refresh queue with specific update recommendations per page...
contentcontent-refreshdecay
Audit v1.0

Core Web Vitals CrUX Segment Audit

Compares CrUX field data across device and connection segments to locate CWV regressions.

You are a Core Web Vitals performance analyst. Using the CrUX API data provided for {domain}, break down LCP, INP, and CLS scores by device type (mobile/desktop) and effective connection type. Identify which segments fail the 'Good' threshold, correlate with page template, and output a ranked fix list...
auditcore-web-vitalscrux
Audit v1.0

Duplicate Content Parameter Audit

Detects URL parameter combinations generating duplicate or near-duplicate content at scale.

Act as a duplicate content specialist. For the site {domain}, analyze the following list of parameterized URLs and their content fingerprints: {url_fingerprint_list}. Group URLs by near-duplicate clusters (similarity threshold: {threshold}%), identify the canonical version for each cluster, and recommend parameter handling rules for robots.txt or GSC...
auditduplicate-contentparameters
Content v1.0

E-E-A-T Author Profile Builder

Builds a comprehensive author bio and credential schema to strengthen E-E-A-T signals.

Act as an E-E-A-T optimization specialist. For the author {author_name} who writes about {topic_area} on {domain}, draft a full author bio (150–200 words) that surfaces first-hand experience signals, professional credentials, notable publications, and institutional affiliations. Also generate the corresponding Person schema markup and recommend three off-page authority-building actions...
contente-e-a-tauthor
GEO v1.0

Entity Salience Association Audit

Measures how strongly a brand entity is associated with target topics in LLM training signals.

Act as an entity association analyst. For {brand}, test the following target topic associations: {topic_list}. For each topic, prompt ChatGPT and Perplexity with 'What are the leading [topic] providers?' and record whether {brand} appears. Summarize salience scores and recommend content and PR actions to strengthen missing associations...
geoentitybrand-association
Content v1.0

FAQ Block Intent Generator

Generates FAQ blocks mapped to real PAA and AI Overview sub-questions for a target topic.

You are a FAQ content specialist. For the topic {topic}, generate a FAQ block of {n} questions and answers that covers the most frequently surfaced People Also Ask questions and AI Overview sub-questions on the SERP. Each answer must be 40–60 words, factually precise, and formatted to qualify for FAQPage schema markup. Include the complete FAQPage JSON-LD block at the end...
contentfaqschema
Ranking v1.0

Featured Snippet Format Selector

Determines the optimal featured snippet format (paragraph, list, table) for a given query.

Act as a featured snippet optimization expert. For the query {query}, analyze the current SERP snippet format and the question type. Recommend whether a paragraph, ordered list, unordered list, or table format is most likely to win the snippet, provide a content length target, and write a compliant example answer block ready for insertion into {url}...
rankingfeatured-snippetserp
GEO v1.0

Generative SERP Source Preference Model

Models which content source attributes drive LLM selection for a specific topic cluster.

Act as a generative SERP researcher. For the topic cluster {topic_cluster}, analyze the top 10 sources cited across ChatGPT, Perplexity, and Google AI Overview. Extract shared attributes (domain authority signals, content format, schema usage, author credentials, publication recency) and build a predictive source selection model. Apply this model to {domain} and identify the highest-leverage improvement actions...
geosource-authorityllm
GEO v1.0

GEO Content Brief Entity Depth

Builds a GEO-optimized content brief that maximizes entity depth for LLM source selection.

You are a GEO content strategist. Create a content brief for the topic {topic} specifically optimized for generative engine retrieval. The brief must specify required entities, supporting facts, citation-worthy statistics, ideal content format, recommended passage structure, and FAQ sections that directly answer the sub-questions LLMs are likely to generate...
geocontent-briefentity
Audit v1.0

Hreflang Return Tag Matrix Audit

Verifies bidirectional hreflang return tags across all locale variants and surfaces missing pairs.

You are an international SEO auditor. Using the hreflang tag inventory below for {domain}, build a locale-pair matrix and identify all instances where a return tag is absent (i.e., page A references page B but page B does not reference page A). Output a CSV of broken pairs with recommended corrections...
audithreflanginternational
Technical v1.0

Hreflang XML Sitemap Locale Builder

Generates a complete hreflang XML sitemap covering all locale variants for an international site.

Act as an international SEO technical specialist. For {domain}, generate a complete XML sitemap using the sitemap hreflang extension for the following locale variants: {locale_url_mapping}. Ensure every URL set includes the x-default tag, correct ISO 639-1 language codes, ISO 3166-1 country codes, and absolute URLs. Output the complete XML and a validation checklist...
technicalhreflangsitemap
Ranking v1.0

Image SERP Optimization Brief

Creates an optimization brief for image assets to improve rankings in Google Image Search.

Act as an image SEO strategist. For the page {url} targeting the keyword {keyword}, audit the existing image assets (provided below) and produce an optimization brief covering: filename conventions, alt text rewrites, captions, surrounding text context, image schema markup, file size/format recommendations, and Google Lens discoverability signals...
rankingimage-serpoptimization
Technical v1.0

INP Interaction Event Trace Fix

Traces slow INP interaction events in the main thread and prescribes JS optimization fixes.

You are an INP optimization specialist. Using the Chrome DevTools performance trace and field INP data for {url}, identify the longest interaction events (input delay + processing time + presentation delay > 200ms). For each event, trace the responsible JavaScript tasks, pinpoint the script source, and recommend specific fixes: task splitting, scheduler.postTask(), event handler debouncing, or third-party script management...
technicalinpperformance
Audit v1.0

Internal Link Depth Distribution Audit

Audits click depth of strategic pages and flags URLs buried beyond three clicks from the homepage.

Act as an internal link architecture auditor. Using the crawl export below for {domain}, compute the click depth from the homepage for every URL and produce a distribution table. Highlight all high-priority pages (defined by {priority_signal}) that sit deeper than three clicks, and propose link insertion points to reduce depth...
auditinternal-linkscrawl
Ranking v1.0

Keyword Cannibalization Intent Resolver

Resolves cannibalization conflicts by realigning page targets to distinct intent layers.

Act as a keyword cannibalization specialist. The following pages on {domain} are competing for the keyword {keyword}: {cannibalizing_url_list}. Analyze the intent, content depth, and authority signals of each page. Recommend which URL should be the designated target, what to do with the others (redirect, consolidate, noindex, or differentiate), and provide a canonical and internal linking correction plan...
rankingcannibalizationintent
Technical v1.0

JSON-LD Organization Schema Builder

Generates a complete JSON-LD Organization schema block with all recommended properties populated.

You are a structured data engineer. Generate a complete JSON-LD Organization schema block for {brand} using the following business details: {business_details}. Include all properties recommended by Google's structured data guidelines: name, url, logo, sameAs (all social profiles and Wikidata), contactPoint, address, and foundingDate. Validate the output against schema.org and flag any missing recommended properties...
technicalschemajson-ld
Ranking v1.0

Knowledge Panel Attribute Gap Fixer

Identifies missing or incorrect knowledge panel attributes for a brand and prescribes fixes.

Act as a knowledge panel optimization specialist. For the brand entity {brand}, compare the current Google Knowledge Panel attributes against the complete Wikidata and schema.org entity profile. List every missing attribute, incorrect value, or unsupported claim, and for each provide the specific action required (Wikidata edit, structured data update, Wikipedia change, or Google Business Profile update)...
rankingknowledge-panelentity
Technical v1.0

LCP Resource Load Optimizer

Traces the LCP element's resource load chain and prescribes fixes to hit the 2.5s good threshold.

Act as a Core Web Vitals performance engineer. Using the WebPageTest waterfall and CrUX LCP data for {url}, identify the LCP element, trace its full resource load chain (render-blocking resources, discovery delay, load delay, render delay), and prescribe specific fixes: preload hints, font-display settings, image format/size changes, or third-party deferral. Provide before/after LCP time estimates for each fix...
technicallcpperformance
Ranking v1.0

Local Pack Competitor Signal Audit

Reverse-engineers the local pack ranking signals of top-3 competitors for a target query.

You are a local SEO analyst. For the query '{local_query}' in {location}, the top 3 local pack results are {competitor_list}. Analyze each competitor's Google Business Profile completeness, review count/rating, citation volume, proximity signal, and category selection. Produce a signal gap table comparing {brand} to the pack leaders and recommend the highest-ROI actions...
rankinglocal-packcompetitor
Audit v1.0

Log File Bot Frequency Audit

Analyzes server log files to surface Googlebot crawl frequency anomalies by URL segment.

Act as a log file SEO analyst. Using the server log data below for the domain {domain}, segment Googlebot requests by URL template type, identify which segments are over- or under-crawled relative to their traffic value, and flag any crawl frequency drops in the last {timeframe}...
auditlog-filecrawl-budget
GEO v1.0

LLM Recency Freshness Gap Audit

Diagnoses whether content recency signals are limiting LLM citation of a domain's pages.

You are a GEO recency analyst. For the domain {domain}, evaluate whether publication dates, last-modified signals, and content update frequency are contributing to reduced citation rates in real-time LLMs (Perplexity, ChatGPT Browse). Compare {domain}'s recency profile against top-cited competitors for {topic} and recommend a content freshness roadmap...
georecencycitation
Audit v1.0

Mobile-First Indexing Gap Checker

Compares mobile and desktop rendered content to surface mobile-first indexing discrepancies.

Act as a mobile-first indexing auditor. Given the desktop HTML and mobile HTML snapshots below for {url}, diff the two to identify any content present on desktop but absent on mobile (text, structured data, internal links, images). For each discrepancy, classify its SEO severity and suggest a remediation step...
auditmobile-firstrendering
GEO v1.0

Multi-LLM Answer Gap Matrix

Compares answers from multiple LLMs for a query set to find brand visibility gaps across models.

Act as a multi-LLM visibility analyst. For each query in {query_list}, paste the verbatim responses from ChatGPT, Claude, Gemini, and Perplexity. Build a matrix showing which queries include a mention of {brand}, in which models, and with what sentiment. Identify the models where brand coverage is absent and diagnose likely causes...
geomulti-llmbrand-visibility
Ranking v1.0

News SERP Freshness Signal Optimizer

Prescribes on-page and technical freshness signals to improve News SERP and Top Stories inclusion.

You are a News SEO specialist. For the article at {url} targeting the topic {topic}, audit the following freshness signals: publication timestamp markup, last-modified header, content update recency, structured data (NewsArticle schema), internal link recency context, and XML news sitemap inclusion. Provide a freshness signal improvement checklist ranked by implementation effort...
rankingnews-serpfreshness
Audit v1.0

Orphan Page Link Opportunity Audit

Finds orphaned pages and recommends contextual internal link placements to re-integrate them.

Act as an internal linking strategist. The following pages on {domain} have zero internal links pointing to them: {orphan_url_list}. For each orphan URL, identify the three most topically relevant pages already in the site that should link to it, and provide suggested anchor text and placement context...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Intent Cluster Builder

Mines People Also Ask questions for a seed keyword and organizes them into intent sub-clusters.

You are a SERP research analyst. For the seed keyword {keyword}, extract all available People Also Ask questions from the SERP and group them into thematic intent sub-clusters. For each cluster, identify the dominant user intent, recommend a content format, and suggest which existing page on {domain} should target each cluster or flag where a new page is needed...
rankingpaaintent
GEO v1.0

Perplexity Source Authority Gap

Identifies why competitor domains are cited in Perplexity over your own and maps authority gaps.

Act as a GEO strategist. For the query set {query_list}, document which domains Perplexity cites most frequently and analyze what content attributes (format, depth, entity density, recency) distinguish cited sources from {domain}. Produce an authority gap table and a 90-day content action plan to close the citation deficit...
geoperplexitycitation
Technical v1.0

Prerender Bot Detection Config

Configures bot-detection logic to serve pre-rendered HTML to search crawlers from a JS-heavy site.

You are a prerendering SEO engineer. For the {framework} site at {domain}, write the middleware configuration that detects known search engine crawlers via User-Agent string, serves pre-rendered static HTML from {prerender_service} cache for those requests, and passes all other traffic to the normal client-rendered experience. Include a User-Agent allowlist, cache TTL settings, and a bypass rule for authenticated routes...
technicalprerenderingrendering
Content v1.0

Programmatic Content Template Mapper

Designs scalable programmatic content templates with variable slots for data-driven page generation.

Act as a programmatic SEO architect. For the page type {page_type} on {domain} targeting the pattern '{url_pattern}', design a content template that includes: a dynamic H1 formula, variable content slots (populated from {data_source}), static E-E-A-T anchor sections, internal link logic, and schema markup type. Provide a filled example using sample data and quality-control criteria for auto-generated pages...
contentprogrammatictemplate
Audit v1.0

Redirect Chain Hop Counter

Maps multi-hop redirect chains and scores each by PageRank dilution risk.

You are a redirect chain auditor. Analyze the following redirect chain data for {domain}: {redirect_chain_csv}. For each chain longer than two hops, calculate cumulative redirect overhead, estimate PageRank dilution percentage, and recommend whether to consolidate to a single 301 or update source links directly...
auditredirectstechnical
Content v1.0

Schema-Rich Explainer Drafter

Drafts an explainer article with embedded schema markup signals optimized for rich result eligibility.

Act as a schema-aware content writer. Draft a 1,000-word explainer article on {topic} for {domain} that naturally incorporates signals eligible for multiple schema types: Article, FAQPage, and HowTo. After the article, provide the complete JSON-LD markup covering all three types, cross-referencing the article content. The draft must satisfy E-E-A-T signals for the {industry} niche...
contentschemarich-results
Audit v1.0

Schema Type Coverage Auditor

Reviews which schema.org types are missing or misconfigured across key page templates.

You are a structured data auditor. For the site {domain}, review the following list of page templates and their current schema markup: {template_schema_list}. Identify which schema types are absent, partially implemented, or contain validation errors per Google's Rich Results requirements, and output a gap table with recommended fixes...
auditschemarich-results
Technical v1.0

Security Headers CSP SEO Config

Configures Content-Security-Policy and security headers in a way that avoids blocking SEO rendering.

Act as a security and SEO header specialist. For {domain}, write a Content-Security-Policy header that satisfies modern security requirements while explicitly permitting: Googlebot rendering of JavaScript, structured data scripts, tag manager snippets, and analytics. Also configure X-Frame-Options, Referrer-Policy, and Permissions-Policy. Flag any directives that are known to interfere with search engine rendering and provide safe alternatives...
technicalsecurity-headerscsp
Ranking v1.0

SERP Intent Volatility Classifier

Classifies a keyword list by intent stability to prioritize targeting by SERP consistency.

You are a SERP intent analyst. For the following keyword list: {keyword_list}, classify each keyword's dominant intent (informational, navigational, commercial, transactional) and score its intent volatility (how frequently the SERP intent type shifts) on a Low/Medium/High scale. Prioritize the stable-intent, high-value keywords and flag volatile ones as high-risk content targets...
rankingintentserp
Technical v1.0

Server-Side Rendering SEO Config Spec

Produces a framework-specific SSR configuration spec ensuring full SEO content rendering.

You are a rendering SEO engineer. For the {framework} application at {domain}, audit the current SSR configuration and identify any components that fall back to client-side rendering for SEO-critical content (headings, body text, internal links, structured data). Produce a corrected SSR configuration spec with code examples showing how to move each identified component to server-rendered output...
technicalssrrendering
Ranking v1.0

Shopping SERP Feed Attribute Gap

Identifies missing or weak product feed attributes limiting Shopping SERP performance.

You are a Shopping SERP optimization expert. Review the following product feed sample for {brand}: {feed_sample}. Compare attributes against Google Merchant Center's best-practice requirements and the attributes used by top-ranking competitors for the query {target_query}. List every attribute gap, score its impact, and provide corrected attribute values for each affected product...
rankingshopping-serpfeed
Audit v1.0

Technical Site Crawl Gap Audit

Identifies crawl gaps and unreachable URLs across a site using crawl data exports.

You are an expert technical SEO auditor. Given the following crawl data export from {crawl_tool}, identify all URLs that are unreachable, excluded, or uncrawled despite being linked internally. Group findings by root cause (blocked by robots.txt, noindex, orphan, redirect loop) and provide a prioritized remediation checklist...
auditcrawltechnical
Content v1.0

Title Tag SERP CTR Rewriter

Rewrites underperforming title tags using CTR psychology and SERP display rules.

Act as a conversion-focused SEO copywriter. For the following pages with below-average CTR in GSC: {page_ctr_list}, rewrite each title tag to be under 60 characters, front-load the primary keyword, incorporate a CTR-boosting modifier (e.g., year, number, qualifier), and maintain brand consistency for {brand}. Provide the original vs. rewritten version and the CTR hypothesis for each...
contenttitle-tagctr
Technical v1.0

XML Sitemap Split Segmentation Spec

Designs a multi-sitemap index architecture segmented by page type for large-scale sites.

You are an XML sitemap architect. For {domain}, which has {total_url_count} indexable URLs across page types: {page_type_list}, design a sitemap index architecture that splits URLs into individual sitemaps by template type, sets appropriate lastmod and changefreq values per type, and stays within the 50,000 URL and 50MB limits. Provide the full sitemap index XML and one example child sitemap...
technicalsitemaparchitecture
GEO v1.0

AI Mode Topical Cluster Planner

Plans content clusters specifically architected for visibility in Google's AI Mode.

Design a topical cluster strategy for {domain} targeting AI Mode visibility in the '{topic}' space. For each cluster, specify the hub page angle, spoke page topics, interlinking logic, and the answer formats (step-by-step, comparison, definition) most likely to be surfaced in AI Mode responses...
geoai-modetopical-authority
GEO v1.0

AI Overview Passage Depth Scorer

Scores your content passages for depth and specificity against AI Overview inclusion criteria.

Evaluate the following content passages from {url} against the query '{target_query}'. For each passage, score it 1–10 on factual depth, specificity, answer completeness, and source trustworthiness. Identify which passages are most likely to be extracted into an AI Overview and recommend rewrites for underperforming ones...
geoai-overviewcontent
GEO v1.0

Brand Mention Context Gap Finder

Identifies contexts where competitors are mentioned by LLMs but your brand is absent.

Query ChatGPT and Perplexity with the following prompts that mention competitors of {brand}: {query_list}. For each response, note the context in which competitors are referenced. Identify recurring contexts where {brand} is absent and produce a content brief for each gap...
geobrandcompetitor
Ranking v1.0

Branded Query Impression Share Plan

Builds a plan to maximize branded SERP impression share across all branded query variants.

Analyze GSC data for {domain} to identify all branded query variants, their current impressions, CTR, and average position. Identify branded queries where impression share is below 90% or competitors appear. Produce a plan to maximize branded SERP ownership including sitelinks, FAQ schema, and content actions...
rankingbrandedserp
Audit v1.0

Canonical Chain Conflict Audit

Detects canonical tags that point to other canonical-tagged URLs, creating signal conflicts.

Analyze the canonical tag data for {domain} from the following crawl export: {crawl_data}. Identify all chained canonicals (A→B→C), self-referencing conflicts, canonical-noindex contradictions, and cross-domain canonical misuse. Output a fix plan with corrected canonical URLs...
auditcanonicaltechnical
Technical v1.0

CDN Cache Header SEO Audit

Audits CDN cache-control headers for conflicts with Googlebot crawl freshness.

Audit the Cache-Control and Surrogate-Control headers returned by {domain}'s CDN for the following URL types: {url_type_list}. Identify TTL values that may cause Googlebot to receive stale content, missing Vary headers, and incorrect no-store/no-cache directives. Output a corrected header configuration per URL type...
technicalcdncache
GEO v1.0

ChatGPT Source Selection Analysis

Analyzes which content signals lead ChatGPT to select or skip a domain as a source.

Using the following ChatGPT responses and cited sources for queries in the {topic} niche, analyze the common content signals (structure, authority markers, recency, entity density) shared by cited sources. Compare against {domain}'s content and produce a prioritized list of changes to improve citation likelihood...
geochatgptcitation
GEO v1.0

Citation Signal Pre-Publish Checklist

Validates a draft article against LLM citation signals before it goes live.

Review the following draft article targeting the query '{target_query}': {article_draft}. Score it against LLM citation signals: factual density, source attribution, author E-E-A-T markers, structured answer formats, entity completeness, and passage extractability. Output a pass/fail checklist with specific edits...
geocitationpre-publish
Ranking v1.0

Competitor Content Gap Rank Map

Maps keywords competitors rank for that your site does not, sorted by traffic opportunity.

Compare the ranking keyword sets of {domain} and {competitor_domain} for the topic area '{topic}'. Identify all keywords where {competitor_domain} ranks in positions 1–20 and {domain} does not rank at all. Sort by estimated monthly search volume and output a gap map with content type recommendations...
rankingcompetitorgap-analysis
Content v1.0

Content Brief SERP Intent Match

Generates a content brief precisely aligned to the dominant intent of a target SERP.

Analyze the top 10 results for '{target_keyword}' and classify the dominant search intent (informational, navigational, commercial, transactional). Generate a content brief for {domain} specifying the required content type, angle, headers, word count range, media types, and schema to match and outperform the current SERP...
contentbriefintent
Content v1.0

Content Decay Traffic Recovery Brief

Diagnoses traffic loss on declining pages and prescribes a content recovery plan.

Analyze the following pages on {domain} that have lost more than 30% of organic traffic in the last 6 months: {url_list}. For each page, diagnose the primary decay cause (freshness, competitor improvement, SERP feature cannibalization, intent shift) and produce a specific content recovery brief including required updates...
contentdecayrecovery
Content v1.0

Content Outline Authority Signals

Structures a content outline with embedded E-E-A-T authority signals at each section.

Create a detailed content outline for an article targeting '{target_keyword}' on {domain}. For each H2 and H3 section, specify the required content, and embed explicit E-E-A-T signals (author expertise cues, first-hand experience callouts, cited data points, trust markers). Format as a writer-ready brief...
contentoutlinee-e-a-t
Audit v1.0

Core Web Vitals Lab vs Field Audit

Compares lab and field CWV scores to diagnose real-user experience gaps.

Compare the following Lighthouse lab scores and CrUX field data for {url}: {lab_data} vs {field_data}. Identify which metrics diverge most, explain probable causes (e.g., third-party scripts, font loading, layout shifts), and recommend fixes ranked by impact on field scores...
auditcore-web-vitalsperformance
Content v1.0

E-E-A-T Author Bio Optimizer

Rewrites author bios to maximize E-E-A-T signals visible to search quality raters.

Rewrite the following author bio for {author_name} to maximize E-E-A-T signals: {existing_bio}. The rewrite must surface first-hand experience, professional credentials, published works, industry recognition, and relevant affiliations. Target 100–150 words and include structured author schema markup...
contente-e-a-tauthor
Technical v1.0

Edge SEO Redirect Worker Spec

Writes a Cloudflare Worker to handle complex redirect logic at the edge.

Write a Cloudflare Worker script for {domain} that implements the following redirect rules: {redirect_rules}. The worker must handle 301 redirects for legacy URL patterns, preserve query strings where specified, apply geo-based redirects for {locale_list}, and log redirect events to a KV store. Include error handling...
technicaledge-seoredirects
Content v1.0

FAQ Entity Schema Content Block

Drafts FAQ content blocks enriched with entities and FAQ schema markup.

Generate a FAQ content block for the topic '{topic}' targeting the query cluster {query_cluster}. Write 8–10 question-and-answer pairs, embedding relevant named entities in each answer. Format each answer for featured snippet extraction (40–60 words). Append the complete FAQPage JSON-LD schema block...
contentfaqschema
Ranking v1.0

Featured Snippet Format Classifier

Classifies the snippet format type for a target query set to guide content formatting.

For the following list of target queries: {query_list}, classify the current featured snippet format (paragraph, list, table, step-by-step, code block, or none). For each query, specify the exact content format, word count range, and structural pattern needed to capture the snippet from {competitor_domain}...
rankingfeatured-snippetserp
GEO v1.0

GEO Entity Prominence Brief

Builds a brief to increase brand entity prominence in LLM training-relevant content.

Create a GEO entity prominence brief for {brand} targeting the topic cluster '{topic_cluster}'. Identify the key entities, attributes, and relationships LLMs associate with this cluster. Specify which entities {brand} is currently missing from, and outline content actions to strengthen entity co-occurrence signals...
geoentitybrand
Audit v1.0

Hreflang Return Tag Consistency Audit

Verifies bidirectional hreflang annotations are complete and self-referencing.

Review the hreflang tag data for {domain} across the following locale set: {locale_list}. Flag any pages missing return tags, self-referencing tags, or x-default assignments. Output a locale-by-locale compliance matrix and a corrected tag block for each failing page...
audithreflanginternational
Technical v1.0

Hreflang XML Sitemap Generator

Generates a complete hreflang sitemap for a multilingual site structure.

Generate a valid hreflang XML sitemap for {domain} supporting the following locales: {locale_list}. Use the URL structure pattern {url_pattern}. For each URL set, include all hreflang annotations with correct lang-region codes and x-default assignment. Output the complete sitemap XML and flag any locale pairing conflicts...
technicalhreflangsitemap
Audit v1.0

Image Alt Text SEO Audit

Reviews image alt attributes site-wide for SEO completeness and keyword alignment.

Audit the following list of images and their alt text values crawled from {domain}: {image_alt_data}. Flag missing alt text, duplicate alt text across multiple images, keyword-stuffed alts, and decorative images incorrectly using descriptive text. Produce a prioritized remediation list with suggested alt text...
auditimagesaccessibility
Ranking v1.0

Image SERP Structured Data Brief

Produces a structured data and metadata brief to improve image SERP appearances.

Analyze the image SERP for the query '{target_query}'. Identify the top 10 ranking images and their shared metadata patterns (alt text structure, surrounding text, file naming, schema type, page topic). Produce a brief specifying how {domain} should optimize its images to rank in this image SERP...
rankingimage-serpstructured-data
Technical v1.0

INP Interaction Trace Diagnosis

Traces the root cause of poor INP scores to specific interaction types and DOM elements.

Analyze the following Chrome DevTools performance trace and CrUX INP data for {url}: {trace_data}. Identify the specific interactions (click, keydown, pointer) causing the highest input delay, processing time, and presentation delay. Map each to the responsible script or DOM element and prescribe fixes...
technicalinpcore-web-vitals
Content v1.0

Internal Link Anchor Text Optimizer

Audits and rewrites internal link anchors to maximize keyword relevance signaling.

Review the internal links pointing to {target_url} on {domain}. List all current anchor texts, their source pages, and their proximity to the target keyword '{target_keyword}'. Flag over-optimized, generic, or irrelevant anchors. Provide rewritten anchor text recommendations for each link with rationale...
contentinternal-linksanchor-text
Audit v1.0

JS Rendering Content Delta Audit

Compares raw HTML against rendered DOM to find content hidden from crawlers.

Compare the raw HTML source and fully rendered DOM for the following URLs on {domain}: {url_list}. Identify all text, links, and structured data present in the rendered DOM but absent from the raw HTML. Classify each delta by SEO risk (critical, moderate, low) and recommend a rendering fix...
auditjavascriptrendering
Technical v1.0

JSON-LD Breadcrumb Schema Builder

Generates valid BreadcrumbList JSON-LD for any URL based on its site hierarchy.

Generate a valid BreadcrumbList JSON-LD schema block for the URL {target_url} on {domain}. The site hierarchy is: {breadcrumb_hierarchy}. Ensure each ListItem includes the correct @type, position, name, and item properties. Validate against Google's rich result requirements and flag any missing fields...
technicalschemajson-ld
Ranking v1.0

Keyword Cannibalization Intent Split

Resolves cannibalization by separating conflicting pages based on search intent.

Analyze the following pairs of URLs on {domain} that are competing for the same keyword '{target_keyword}': {url_pairs}. For each pair, classify the intent difference (informational vs transactional, broad vs specific), recommend which URL to consolidate or differentiate, and specify canonical, redirect, or content changes required...
rankingcannibalizationintent
Ranking v1.0

Knowledge Panel Attribute Optimizer

Identifies missing or incorrect entity attributes in a brand's knowledge panel.

Audit the current Google Knowledge Panel for {brand}. List all attributes currently displayed and compare against the complete attribute set for this entity type. Flag missing attributes, incorrect data, and inconsistent information across Wikidata, Google Business Profile, and structured data on {domain}. Output a correction action plan...
rankingknowledge-panelentity
Technical v1.0

LCP Resource Load Chain Fix

Diagnoses and resolves the critical resource chain blocking LCP element load time.

Analyze the WebPageTest waterfall and LCP element data for {url}. Identify the complete resource load chain blocking the LCP element from rendering (render-blocking scripts, unpreloaded hero images, font swap delays, third-party chain dependencies). Produce a specific fix spec including preload hints, resource hints, and script deferral changes...
technicallcpperformance
GEO v1.0

LLM Recency Signal Optimizer

Diagnoses whether content recency signals are reducing LLM citation rates.

Audit the following pages on {domain} that target high-value LLM query clusters: {url_list}. For each page, assess recency signals visible to LLMs (publication date, last-modified header, content freshness markers, recent data citations). Score each page and recommend specific updates to strengthen recency signals...
georecencyllm
Ranking v1.0

Local Pack Citation Consistency Audit

Checks NAP consistency across directories that influence local pack rankings.

Audit the NAP (Name, Address, Phone) data for {business_name} across the following citation sources: {citation_source_list}. Flag all inconsistencies, duplicates, and missing listings. Score overall citation health and provide a prioritized cleanup plan ranked by local pack ranking impact...
rankinglocal-seocitations
Audit v1.0

Log File Bot Segment Analyzer

Parses server log data to segment bot traffic by crawler type and frequency.

Analyze the following server log extract for {domain} and segment all non-human bot requests by crawler name, frequency, crawl rate, and most-requested URL paths. Flag any bots consuming disproportionate crawl budget and recommend rate-limit or disallow directives...
auditlog-filecrawl
Content v1.0

Meta Description SERP CTR Rewriter

Rewrites meta descriptions to improve click-through rate based on SERP competition.

Rewrite the meta descriptions for the following URLs on {domain}: {url_meta_list}. For each, analyze the current SERP competition, identify the emotional hook, USP, or feature callout most likely to drive clicks, and write a new description under 155 characters that differentiates the listing. Output old vs new in a table...
contentmeta-descriptionctr
GEO v1.0

Multi-LLM Answer Coverage Tester

Tests how consistently your brand appears across answers from multiple LLMs for the same query.

Run the query '{target_query}' through ChatGPT, Claude, Perplexity, and Gemini. For each response, record whether {brand} is mentioned, the sentiment of the mention, the position in the response, and whether a source link is provided. Output a cross-LLM coverage scorecard...
geomulti-llmbrand
Ranking v1.0

News SERP Freshness Signal Plan

Diagnoses freshness signals blocking a site from appearing in News SERP features.

Audit {domain}'s eligibility and performance in the News SERP for the topic '{topic}'. Evaluate publication frequency, article structured data, NewsArticle schema, IndexNow implementation, date markup accuracy, and Google News inclusion status. Output a freshness signal improvement plan...
rankingnews-serpfreshness
Audit v1.0

Orphan Page Link Equity Audit

Finds pages with no internal links pointing to them and quantifies lost equity.

Using the crawl data and internal link graph for {domain}, identify all pages with zero internal inlinks. For each orphan page, report its estimated organic traffic, backlink count, and suggested parent page for re-linking. Prioritize by traffic and backlink value...
auditinternal-linksorphan
Ranking v1.0

People Also Ask Intent Mapper

Maps PAA questions to funnel stages and content gaps across a keyword cluster.

Extract all People Also Ask questions for the seed query '{seed_query}' and its top 5 related queries. Map each PAA question to a funnel stage (awareness, consideration, decision), identify which questions {domain} currently answers, and flag gaps. Output a PAA content brief for each uncovered question...
rankingpaacontent-gap
GEO v1.0

Perplexity Citation Competitor Map

Maps which competitor domains Perplexity cites most for your target query set.

For the following set of queries: {query_list}, record which domains Perplexity cites in its answers. Build a citation frequency table ranking competitors by total citations, average citation position, and query topic coverage. Identify gaps where {domain} is absent and suggest content angles to capture citations...
geoperplexitycompetitor
Content v1.0

Programmatic Content Template Audit

Audits programmatic page templates for thin content and differentiation failures.

Audit the programmatic content templates used on {domain} for the page type '{page_type}'. Evaluate each template section for content uniqueness, value-add beyond competitor pages, entity coverage, and thin content risk. Score each template and recommend specific dynamic content modules to add differentiation...
contentprogrammaticthin-content
Audit v1.0

Redirect Chain Consolidation Audit

Detects multi-hop redirect chains and calculates equity loss at each hop.

Analyze the following list of redirect paths for {domain}: {redirect_list}. Identify all chains with 2 or more hops, calculate cumulative PageRank loss, flag any redirect loops, and produce a consolidation plan that collapses each chain to a single 301...
auditredirectstechnical
Technical v1.0

Robots.txt Crawl Budget Optimizer

Rewrites robots.txt to protect crawl budget by blocking low-value URL patterns.

Review the current robots.txt for {domain}: {robots_txt_content}. Cross-reference with the crawl log data showing Googlebot's most-crawled low-value paths. Produce an optimized robots.txt that blocks faceted navigation, session IDs, internal search, and staging paths while preserving all indexable content...
technicalrobots-txtcrawl-budget
Audit v1.0

Schema Markup Gap Type Audit

Identifies missing or incomplete schema types across key page templates.

Review the following list of page templates and their current schema.org markup for {domain}: {page_template_list}. For each template, identify which schema types are missing, partially implemented, or malformed. Output a gap table with recommended schema types and required properties per template...
auditschemarich-results
Content v1.0

Schema-Rich How-To Content Drafter

Drafts step-by-step how-to content with embedded HowTo schema ready for publishing.

Write a schema-optimized how-to article for '{task}' targeting the keyword '{target_keyword}'. Structure each step with a clear name, image alt text placeholder, and 2–3 sentence description. Append a complete HowTo JSON-LD schema block with all steps, estimated time, and required tools...
contenthow-toschema
Technical v1.0

Security Headers CSP SEO Spec

Writes a Content Security Policy that enforces security without blocking crawler rendering.

Write a Content-Security-Policy header for {domain} that satisfies the following security requirements: {security_requirements}. Ensure the policy does not block Googlebot's ability to render JavaScript, load CSS, or access third-party resources required for page rendering. Flag any directives that would cause rendering failures...
technicalsecurity-headerscsp
Ranking v1.0

SERP Volatility Cause Diagnosis

Diagnoses root causes of ranking volatility for a specific keyword set.

Analyze the ranking volatility data for the following keywords on {domain} over the past 90 days: {keyword_rank_history}. Correlate volatility spikes with algorithm update dates, competitor content changes, and SERP feature fluctuations. Identify the most likely root causes and recommend stabilization actions...
rankingvolatilityalgorithm
GEO v1.0

Source Authority Signal Model

Models which authority signals most influence LLM source selection in your niche.

Analyze the top 20 sources cited by LLMs for queries in the '{niche}' space. Identify the authority signals they share (domain age, backlink profile, author credentials, citation count, structured data use). Build a scoring model that benchmarks {domain} against these signals and outputs a gap-closure roadmap...
geoauthorityllm
Technical v1.0

SSR Hydration SEO Config Spec

Specifies SSR hydration configuration to ensure full SEO content availability at crawl time.

Review the current SSR/hydration setup for {domain} built on {framework}. Identify components that hydrate client-side after initial paint, assess whether their content is visible in the raw HTML served to Googlebot, and produce a configuration spec to move critical SEO content (titles, headings, body text, links) into the server-rendered payload...
technicalssrrendering
Audit v1.0

Technical Site Crawl Scope Audit

Maps all crawlable URLs against intended index scope to surface unintended inclusions.

You are an SEO auditor. Given the sitemap XML and crawl export for {domain}, identify all URLs being crawled that should be excluded from indexing, grouped by issue type (noindex missing, robots blocked incorrectly, parameter URLs, staging leaks). Output a prioritized fix table...
auditcrawlindexing
Content v1.0

Topic Cluster Gap Content Map

Identifies missing spoke pages in an existing topic cluster and maps creation priorities.

Audit the existing topic cluster for '{pillar_topic}' on {domain}. List all current spoke pages, identify subtopics covered by competitors but missing from the cluster, and score each gap by search volume and topical relevance. Output a prioritized content creation roadmap for the missing spokes...
contenttopic-clustergap
Technical v1.0

XML Sitemap Index Split Spec

Designs a sitemap index architecture splitting sitemaps by content type and priority.

Design an XML sitemap index architecture for {domain} with {total_url_count} indexable URLs. Split sitemaps by content type: {content_types}. Specify the sitemap index file structure, individual sitemap file naming, URL inclusion/exclusion rules, lastmod signal strategy, and priority/changefreq guidance. Output the sitemap index XML...
technicalsitemaparchitecture
GEO v1.0

AI Mode Content Fit Audit

Scores pages against Google AI Mode retrieval criteria and recommends structural improvements.

Evaluate the page at {url} for its fitness to appear in Google AI Mode responses for the query {query}. Score the page on: answer directness, entity density, passage retrievability, E-E-A-T signals, and structured data. Output a scored report with specific content edits to improve AI Mode selection...
geoai-modecontent-fit
GEO v1.0

AI Overview Passage Depth Audit

Evaluates whether page passages are deep enough to be selected as AI Overview source snippets.

Review the page content below for {url} targeting the query {query}. Assess whether individual passages meet Google AI Overview selection criteria: factual density, query-answer alignment, and source authority signals. Output a scored passage list with rewrite recommendations for low-scoring passages...
geoai-overviewpassage-optimization
Ranking v1.0

Branded Query Volatility Tracker

Monitors branded SERP result changes and diagnoses causes of non-brand pages displacing brand results.

Analyze the SERP result history for branded queries {branded_query_list} for {domain} over the period {date_range}. Identify any instances where non-{brand} pages rank above {domain}'s own properties. Diagnose the likely cause (ORM issue, affiliate conflict, news spike) and recommend a defensive SERP plan...
rankingbranded-queriesserp-volatility
Audit v1.0

Broken Link Priority Triage

Ranks broken internal and external links by PageRank impact so teams fix the highest-equity losses first.

Given the broken link report below for {domain} (including source URL, destination URL, HTTP status, and source page internal link equity score), rank all broken links by estimated link equity loss. Output a prioritized fix queue with recommended redirect or replacement targets...
auditbroken-linkslink-equity
Audit v1.0

Canonical Chain Conflict Finder

Detects canonical tags pointing to non-canonical or redirecting URLs and outputs a fix list.

Analyze the canonical tag data below for {domain}. Identify all cases where a canonical URL is itself non-indexable (redirected, canonicalized elsewhere, or returning a non-200 status). Output a conflict table with the source URL, canonical target, issue type, and recommended corrected canonical...
auditcanonicalcrawl
GEO v1.0

ChatGPT Entity Citation Audit

Assesses how strongly ChatGPT associates your brand entity with target topics and surfaces gaps.

Run the following 10 prompts about {topic} through ChatGPT and record responses: {prompt_list}. Analyze how often {brand} is mentioned, in what context, and with what sentiment. Identify competitor brands appearing instead and recommend entity-strengthening content actions...
geochatgptentity
GEO v1.0

Claude Source Preference Audit

Analyzes Claude's citation preferences for a niche and maps gaps your site must address.

Submit the following 15 queries about {topic} to Claude and record all cited or referenced sources: {query_list}. Identify patterns in which content types, domains, and structural formats Claude prefers. Map {domain}'s content against these preferences and output a gap-closure brief...
geoclaudesource-preference
Ranking v1.0

Competitor SERP Share Gap

Quantifies keyword share-of-SERP gaps between your domain and top competitors.

Using the keyword ranking data below for {domain} and competitors {competitor_list}, calculate share of SERP for each domain across the keyword set. Identify keyword clusters where {domain} is absent but competitors rank in the top 3. Output a prioritized opportunity matrix sorted by estimated traffic value...
rankingcompetitorserp-share
Content v1.0

Content Brief SERP Alignment

Generates a fully SERP-aligned content brief by reverse-engineering the top 10 ranking pages.

Analyze the top 10 ranking pages for {keyword} and extract: dominant content format, average word count, heading structure, entities mentioned, FAQ patterns, and schema types used. Generate a complete content brief for {domain} that outperforms the current top result on depth, structure, and E-E-A-T signals...
contentcontent-briefserp
Content v1.0

Content Decay Traffic Brief

Produces a refresh brief for a decaying article by diagnosing why traffic dropped and what to fix.

The page at {url} has lost {traffic_drop}% of organic traffic since {date}. Analyze the ranking history, SERP changes, and content audit data below. Identify whether decay is caused by intent drift, freshness loss, competitor improvement, or coverage gaps. Output a targeted refresh brief with specific rewrite instructions...
contentcontent-decayrefresh
Audit v1.0

Core Web Vitals CrUX Audit

Diagnoses CrUX field data failures by page segment and maps them to root-cause elements.

Using the CrUX field data export below for {domain}, segment failing pages by template type (e.g., PDP, PLP, blog). For each failing segment, identify the most likely root-cause element causing LCP, INP, or CLS failures and recommend specific fixes...
auditcore-web-vitalscrux
Content v1.0

FAQ Entity Schema Block

Generates an FAQ content block with FAQPage schema targeting PAA questions for a topic.

Generate an FAQ content section for the page targeting {keyword} on {domain}. Source questions from the People Also Ask boxes and related searches for {keyword}. Write concise, entity-rich answers for each question and output the full FAQPage JSON-LD schema block alongside the HTML-formatted Q&A content...
contentfaqschema
Ranking v1.0

Featured Snippet Passage Optimizer

Rewrites page passages into featured-snippet-winning formats for a target keyword.

For the target keyword {keyword}, analyze the current featured snippet format (paragraph, list, table, or step-based). Then review the content at {url} and rewrite the most relevant passage into the optimal format to win or displace the current featured snippet. Provide before and after versions with rationale...
rankingfeatured-snippetserp
GEO v1.0

Generative SERP Source Targeting

Creates a plan to get {domain} listed as a source in generative SERP features for target queries.

For the target query set {query_list}, analyze which pages are currently sourced in AI Overviews and generative SERP features. Build a targeting plan for {domain} detailing required content depth, entity associations, and passage structures needed to qualify as a cited source...
geogenerative-serpsource-targeting
Audit v1.0

Hreflang Return Tag Audit

Validates that every hreflang annotation has a corresponding return tag in the target locale page.

Given the hreflang tag data extracted from all pages of {domain}, verify that every x-default and locale-specific annotation has a valid return tag on the referenced page. List all broken pairs with the affected URLs, locale codes, and recommended corrections...
audithreflanginternational
Technical v1.0

Hreflang XML Sitemap Builder

Generates a properly structured XML sitemap with hreflang annotations for a multi-locale site.

Generate an XML sitemap with complete hreflang annotations for {domain}, which targets the following locales: {locale_list}. For each URL set, include the canonical URL, all locale variants with their hreflang codes, and the x-default annotation. Output the full sitemap XML following Google's specified format...
technicalhreflangsitemap
Ranking v1.0

Image SERP Ranking Optimizer

Produces an image SEO action plan to capture image SERP placements for target queries.

Analyze the image SERP results for the query set {query_list}. Identify the file naming conventions, alt text patterns, surrounding context, page authority, and structured data used by top-ranking images. Output an optimization checklist for {domain}'s images to compete for these placements...
rankingimage-serpvisual-search
Content v1.0

Internal Link Gap Recommender

Recommends internal link opportunities from high-authority pages to underlinked target pages.

Given the internal link equity data and content inventory for {domain}, identify the top {n} pages with high PageRank but few outbound internal links. For each, recommend 3-5 contextually relevant target pages to link to with specific anchor text suggestions, based on topical relevance and the target page's ranking goals...
contentinternal-linkslink-equity
Technical v1.0

JSON-LD Organization Schema

Generates a complete Organization JSON-LD block with all recommended properties for brand entity reinforcement.

Generate a complete Organization schema JSON-LD block for {brand}. Include all recommended Schema.org Organization properties: name, url, logo, sameAs (with all social and Wikidata profiles), contactPoint, address, and foundingDate. Validate that property values match the brand's official profiles and output the final script tag...
technicalschemajson-ld
Ranking v1.0

Knowledge Panel Attribute Audit

Audits which knowledge panel attributes are missing or incorrect for a brand or entity.

Review the current Google Knowledge Panel for {entity} and compare it against the structured data and on-page signals at {domain}. Identify missing attributes, incorrect values, and unverified claims. Output a prioritized fix list with the specific schema properties and Wikidata/Wikipedia signals needed...
rankingknowledge-panelentity
Technical v1.0

LCP Resource Chain Optimizer

Traces the LCP resource load chain and outputs a prioritized set of optimizations to reduce LCP time.

Using the WebPageTest waterfall and LCP element data below for {url}, trace the full resource load chain for the LCP element. Identify render-blocking resources, late-discovered LCP images, and server response delays. Output a prioritized optimization plan with specific HTTP header changes, preload hints, and image format recommendations...
technicallcpperformance
GEO v1.0

LLM Recency Gap Optimizer

Identifies content freshness gaps that prevent LLMs from selecting your pages as up-to-date sources.

Analyze the content below from {domain} on the topic {topic}. Identify data points, statistics, and claims that are outdated relative to the current date. Output a freshness upgrade plan listing each stale element, its recommended update, and the likely impact on LLM citation recency signals...
geofreshnessllm
Ranking v1.0

Local Pack Citation Audit

Audits NAP consistency and citation signals to diagnose local pack ranking gaps.

Audit the local citation profile for {business_name} in {location}. Check NAP consistency across the top 30 citation sources, identify conflicting data, and compare citation volume and quality against the current local pack leaders for {target_keyword}. Output a citation repair and building plan...
rankinglocal-packcitations
Audit v1.0

Mobile-First Index Gap Audit

Compares desktop and mobile-rendered HTML to find content, links, or metadata missing on mobile.

Compare the desktop-rendered HTML and mobile-rendered HTML snapshots below for {url}. Identify any content blocks, internal links, structured data, or meta tags present on desktop but absent from the mobile render. Output a gap table with SEO impact ratings...
auditmobile-firstrendering
GEO v1.0

Multi-LLM Source Variance Audit

Compares citation sources across ChatGPT, Claude, Perplexity, and Gemini for a target topic.

For the query set {query_list}, collect responses from ChatGPT, Claude, Perplexity, and Gemini. Build a source citation matrix showing which domains each LLM cites, which are cited by all four, and which gaps {domain} has. Prioritize content investments by cross-LLM citation frequency...
geomulti-llmcitations
Audit v1.0

Orphan Page Link Finder

Identifies pages with no internal links pointing to them and recommends re-integration paths.

Given the full list of URLs from the crawl of {domain} and the internal link graph below, identify all orphan pages (zero inbound internal links). For each orphan, suggest three contextually relevant pages that should link to it, with recommended anchor text...
auditinternal-linksorphan-pages
Ranking v1.0

PAA Intent Gap Miner

Extracts People Also Ask questions for a topic and maps them to content gaps on your site.

For the seed keyword {keyword}, extract all available People Also Ask questions across the top 20 related SERPs. Cluster questions by intent sub-type and map each cluster against existing content on {domain}. Output a gap report with recommended content formats and target pages for each PAA cluster...
rankingpaacontent-gap
GEO v1.0

Perplexity Source Authority Audit

Profiles which authority signals make Perplexity cite a domain and gaps your site must close.

Analyze the Perplexity AI citation patterns for the topic {topic}. Identify which domains are cited most frequently, what content attributes (freshness, depth, structure) they share, and what authority signals {domain} is missing. Output a gap-closure action plan...
geoperplexitysource-authority
Technical v1.0

Prerender Eligibility Audit

Assesses whether pages meet Chrome's prerender eligibility rules and fixes disqualifying conditions.

Evaluate the pages {url_list} for Chrome prerender eligibility using the Speculation Rules API. Check for disqualifying conditions: use of unload handlers, non-idempotent requests on load, cross-origin iframes, and Web Locks. Output an eligibility verdict per page with specific code changes needed to qualify for prerendering...
technicalprerenderperformance
Content v1.0

Programmatic SEO Content Schema

Designs a scalable content and schema template for programmatic page generation at scale.

Design a programmatic content template for {domain} targeting the query pattern {query_pattern}. Define the required content modules (headline formula, intro structure, data table, FAQ block, CTA), variable fields drawn from {data_source}, and the Schema.org types to embed. Include quality-bar rules to prevent thin-content penalties...
contentprogrammatic-seotemplate
Audit v1.0

Redirect Chain Consolidation Planner

Maps multi-hop redirect chains and produces a flattened single-hop redirect consolidation plan.

Analyze the redirect chain data below for {domain}. Identify all chains with three or more hops, calculate equity loss at each hop, and output a consolidation plan that flattens every chain to a single 301 redirect. Include a before/after URL mapping table...
auditredirectscrawl
Technical v1.0

Robots.txt Crawl Optimizer

Rewrites a robots.txt file to protect crawl budget and ensure all valuable content is accessible.

Review the current robots.txt file for {domain} below. Identify any rules that block valuable content from Googlebot, allow access to low-value or duplicate URLs, or conflict with sitemap directives. Output an optimized robots.txt with inline comments explaining every rule change and the crawl budget rationale...
technicalrobots-txtcrawl-budget
Audit v1.0

Schema Coverage Type Audit

Reviews which Schema.org types are missing across page templates and maps them to rich-result opportunities.

Audit the following list of page types and their current structured data implementations for {domain}: {page_type_list}. For each page type, identify missing Schema.org types that could qualify for Google rich results, and output a gap table with priority score...
auditschemarich-results
Content v1.0

Schema-Rich How-To Drafter

Drafts a how-to article with embedded HowTo schema markup targeting a step-based featured snippet.

Write a how-to article targeting the query {keyword} for {domain}. Structure the content with a HowTo schema-compatible format: clear step headings, estimated time, required tools/materials, and an introductory answer passage. Embed the JSON-LD HowTo schema block at the end. Aim for featured snippet eligibility...
contenthow-toschema
Technical v1.0

Security Headers CSP SEO

Designs a Content Security Policy and security header set that improves trust signals without breaking SEO.

Design a complete HTTP security header configuration for {domain} including: Content-Security-Policy (allowing required third-party scripts and analytics), Strict-Transport-Security, X-Content-Type-Options, Referrer-Policy, and Permissions-Policy. Ensure no directives block Googlebot, structured data rendering, or third-party SEO tools. Output the full header spec with implementation notes...
technicalsecurity-headerscsp
Ranking v1.0

SERP Intent Mismatch Resolver

Diagnoses keywords where your ranking page's intent mismatches SERP dominant intent and recommends fixes.

Analyze the top 10 SERP results for {keyword} and classify the dominant search intent (informational, transactional, navigational, commercial). Then review the current ranking page {url} and identify all intent mismatches. Output a prioritized list of content and structural changes to realign page intent...
rankingintentserp
Ranking v1.0

Shopping SERP Feed Gap Audit

Reviews product feed and on-page markup for gaps limiting Shopping SERP eligibility.

Compare the Google Merchant Center product feed for {domain} against the on-page Product schema markup for the same SKUs. Identify mismatched, missing, or low-quality attributes (GTIN, brand, price, availability, description) affecting Shopping SERP eligibility and ranking. Output a field-by-field fix plan...
rankingshopping-serpproduct-feed
Audit v1.0

Technical Site Log Audit

Analyzes server log files to surface crawl anomalies, bot behavior, and wasted crawl budget.

You are an SEO log file analyst. Given the server log export below for {domain}, identify pages receiving disproportionate Googlebot visits, pages never crawled, and any crawl traps. Output a prioritized issue list with fix recommendations...
auditlog-filecrawl-budget
Content v1.0

Title Meta Batch Optimizer

Rewrites a batch of title tags and meta descriptions to maximize CTR using SERP data.

Rewrite the title tags and meta descriptions for the following pages on {domain}: {url_list}. For each page, use the target keyword, current average CTR from Search Console, and the SERP competitor titles provided. Apply proven CTR patterns (numbers, brackets, power words) while keeping titles under 60 characters and metas under 155 characters...
contenttitle-tagsctr
Content v1.0

Topic Cluster Gap Mapper

Identifies missing spoke pages in an existing topic cluster and prioritizes them by traffic opportunity.

Audit the existing topic cluster for {pillar_topic} on {domain}. Map all current spoke pages against a comprehensive list of sub-topics and intent variants for {pillar_topic}. Identify missing spokes, estimate their traffic opportunity, and output a prioritized content calendar with recommended page types and target keywords...
contenttopic-clustercontent-gap
Ranking v1.0

Video SERP Schema Optimizer

Identifies video content missing VideoObject schema and maps the fix to video SERP eligibility.

Audit all video content on {domain} for VideoObject structured data completeness. For each video missing required or recommended properties (name, description, thumbnailUrl, uploadDate, duration, contentUrl), output a JSON-LD template pre-filled with available metadata and flag schema gaps...
rankingvideo-serpschema
Technical v1.0

XML Sitemap Health Auditor

Audits XML sitemap files for errors, excluded URLs, and mismatches with indexing status.

Audit the XML sitemap(s) for {domain} against the following criteria: (1) all listed URLs return 200 status, (2) no canonicalized, redirected, or noindexed URLs are included, (3) lastmod dates are accurate, (4) sitemap size is within limits. Cross-reference with Google Search Console coverage data and output a discrepancy report with fixes...
technicalsitemapindexing
GEO v1.0

AI Mode Query Cluster Planner

Plans content clusters to maximize visibility in Google AI Mode for a target topic.

You are a Google AI Mode visibility strategist. For the target topic {topic} and domain {site_url}, identify the top 20 queries most likely to trigger AI Mode responses in this niche. Group them into thematic clusters, then for each cluster specify: the ideal content format, the entities to feature prominently, the passage structures that improve AI Mode inclusion, and the internal linking pattern to reinforce topical authority...
geoai-modecluster
GEO v1.0

AI Overview Source Readiness Scorer

Scores a page's structural and authority signals for likelihood of AI Overview inclusion.

Act as a Generative Engine Optimization specialist. Evaluate the following page content and metadata from {page_url}: {page_content}. Score it (0–100) against these AI Overview inclusion signals: factual density, source citation quality, answer completeness, entity prominence, passage retrievability, E-E-A-T markers, and structured data presence. Return a total score, a per-signal breakdown, and the top 5 improvements to increase inclusion probability...
geoai-overviewscoring
Content v1.0

Anchor Text Diversity Audit

Analyzes internal anchor text distribution for over-optimization and diversity gaps.

You are an internal link strategist. Analyze the following internal anchor text data for {site_url}: {anchor_data}. Identify (1) anchors that are over-optimized (same exact-match anchor used >30% for a target URL), (2) pages with too few anchor variations, (3) opportunities for branded, partial-match, and natural language anchors. Output a rebalancing plan with specific replacement anchor text recommendations for the top 20 target URLs...
contentanchor-textinternal-links
GEO v1.0

Brand Mention Gap Diagnostic

Identifies web contexts where brand mentions are absent and LLM citation risk is highest.

Act as a brand mention analyst for GEO. For {brand_name}, review the following mention data across authoritative domains: {mention_data}. Identify topic areas and authoritative domains where the brand is mentioned by competitors but not {brand_name}. Score each gap by LLM citation risk and recommend specific PR, content partnership, or structured data actions to close the highest-risk mention gaps...
geobrand-mentionsdiagnostic
Audit v1.0

Broken Link Equity Loss Audit

Quantifies PageRank equity lost through broken internal and external links on a site.

Act as an SEO link equity analyst. Given this broken link report for {site_url}: {broken_link_csv}, calculate the estimated equity loss for each broken internal link using the linking page's authority and number of outbound links. Then identify which broken links point to high-value destination pages and prioritize a fix list by estimated equity recovery impact...
auditbroken-linksequity
Technical v1.0

CDN Cache-Control SEO Spec

Specifies Cache-Control and Vary headers for a CDN config to support fast Googlebot crawling.

Act as a CDN and SEO performance engineer. For {site_url} using {cdn_provider}, write a Cache-Control header specification for each content type: HTML pages, JavaScript bundles, CSS files, images, and API responses. For each, specify: max-age, s-maxage, stale-while-revalidate settings, Vary header requirements, and purge trigger logic. Explain how each setting impacts Googlebot crawl speed, content freshness signaling, and Core Web Vitals...
technicalcdncache-control
GEO v1.0

Citation Pre-Publish Signal Check

Validates a draft article's GEO signals before publishing to maximize LLM citation potential.

Act as a GEO pre-publish reviewer. Evaluate the following draft article intended for {page_url}: {draft_content}. Check it against these LLM citation readiness criteria: factual claim density, presence of citable statistics, entity co-occurrence richness, passage-level answer completeness, author E-E-A-T signals, internal and external link credibility, and structured data markup. Return a pass/fail per criterion with specific edits to make before publishing...
geocitationpre-publish
Ranking v1.0

Cluster Opportunity Traffic Sizer

Estimates the total addressable traffic for a keyword cluster before content investment.

You are a keyword research analyst. For the topic cluster {cluster_topic}, I have the following keyword data: {keyword_data}. Calculate the total addressable search volume for this cluster, segment it by intent stage (awareness, consideration, decision), estimate realistic traffic capture rates at positions 1–3 vs 4–10 based on {site_url}'s current authority, and output a prioritized opportunity sizing report to justify or deprioritize content investment...
rankingclusteropportunity-sizing
Ranking v1.0

Competitor SERP Feature Gap Report

Identifies SERP features competitors own that your site is missing across a keyword set.

Act as a competitive SERP analyst. For the keyword set {keyword_list}, compare the SERP feature ownership of {site_url} against competitors {competitor_list} using the following SERP data: {serp_feature_data}. Build a gap matrix showing which features (featured snippets, PAA, image packs, video carousels, knowledge panels, local packs) each competitor owns that {site_url} does not, and prioritize the top 10 feature capture opportunities by estimated traffic impact...
rankingcompetitor-gapserp-features
Content v1.0

Content Brief SERP Intent Builder

Generates a content brief fully aligned to the dominant SERP intent for a target keyword.

Act as a content strategist. For the target keyword {target_keyword}, analyze the top 10 SERP results and identify the dominant search intent, content format, average content depth, and common heading patterns. Then generate a complete content brief for {site_url} including: recommended title, meta description, H1, section headings with intent rationale, required entities, target word count, internal link anchors, and featured snippet target passage...
contentcontent-briefintent
Content v1.0

Content Gap Competitor Depth Finder

Finds sub-topic depth gaps where competitors rank but your content is thin or absent.

Act as a content gap analyst. Compare the content coverage of {site_url} against competitors {competitor_list} for the topic {topic} using the following content inventory: {content_inventory}. Identify sub-topics where competitors have dedicated, in-depth content but {site_url} has only surface-level coverage or no coverage. Rank gaps by keyword opportunity and output a prioritized expansion roadmap...
contentcontent-gapcompetitor
Content v1.0

Content Refresh Traffic Priority Matrix

Scores existing content for refresh priority using traffic decay, ranking loss, and freshness.

Act as a content refresh strategist. For the following content inventory from {site_url}: {content_inventory_csv}, score each URL across these dimensions: (1) traffic trend over 90 days, (2) ranking position change for primary keyword, (3) content freshness date vs. topic recency requirements, (4) click-through rate vs. average position, (5) competitor content improvements since last update. Output a ranked refresh queue with effort estimates...
contentcontent-refreshprioritization
Audit v1.0

Core Web Vitals CrUX Gap Audit

Compares CrUX field data against lab data to expose real-user performance gaps.

Act as a Core Web Vitals performance engineer. For {site_url}, compare the following CrUX field data metrics (LCP, INP, CLS) against the lab data from PageSpeed Insights: {metrics_table}. Identify where field and lab data diverge by more than 20%, hypothesize the root causes (e.g., third-party scripts, font loading, layout shifts from ads), and produce a ranked remediation plan...
auditcore-web-vitalscrux
Audit v1.0

Duplicate Content Parameter Sweep

Detects URL parameter-driven duplicate content patterns and recommends canonicalization fixes.

You are a technical SEO specialist. Analyze the following list of URLs from {site_url}: {url_list}. Identify all URL parameter combinations (e.g., ?sort=, ?color=, ?page=) that generate near-duplicate content, group them into duplicate clusters, and for each cluster recommend whether to: (a) canonicalize to the clean URL, (b) noindex the variants, or (c) block via robots.txt, with reasoning...
auditduplicate-contentparameters
Technical v1.0

Edge SEO Redirect Worker Builder

Writes a Cloudflare Worker script to handle complex SEO redirect rules at the edge.

Act as an edge SEO engineer. For {site_url} hosted on Cloudflare, write a Cloudflare Worker script that implements the following redirect rules: {redirect_rules_list}. The script must: (1) handle 301 and 302 redirects based on URL path patterns, (2) preserve query strings where specified, (3) implement geo-based redirects for locales {locale_list}, (4) add canonical response headers where applicable, and (5) log redirect hits without impacting performance...
technicaledge-seocloudflare
Content v1.0

E-E-A-T Author Profile Optimizer

Rewrites and structures an author bio to maximize E-E-A-T signals for Google and LLMs.

You are an E-E-A-T specialist. Review the following author bio for {author_name}: {current_bio}. Rewrite it to maximize Experience, Expertise, Authoritativeness, and Trustworthiness signals for both Google's quality raters and LLM citation systems. Include: verifiable credentials, first-hand experience statements, publication history, entity associations, and schema-ready structured author data. Show before/after comparison...
contente-e-a-tauthor
Content v1.0

FAQ Entity Intent Block Generator

Creates FAQ blocks rich with entity signals and PAA-aligned questions for a target page.

Act as a content and schema specialist. For the page targeting {target_keyword} on {site_url}, generate a FAQ block of 8–12 questions and answers that: (1) directly match real PAA questions from Google, (2) incorporate relevant entities from the topic's knowledge graph, (3) are concise enough for featured snippet capture (40–60 words per answer), (4) include natural internal link opportunities, and (5) are ready for FAQPage JSON-LD markup...
contentfaqentity
Ranking v1.0

Featured Snippet Format Win Planner

Identifies the exact snippet format and content structure needed to win position zero.

You are a featured snippet optimization specialist. For the query {target_query}, the current snippet winner is: {current_snippet}. Analyze the snippet format (paragraph, list, table, or code), word count, heading structure, and answer directness. Then rewrite the relevant section of {page_url}'s content to outcompete the current snippet, explaining every structural decision...
rankingfeatured-snippetformat
GEO v1.0

Generative SERP Feature Targeting Plan

Maps a site's content to the generative SERP features most achievable for each target query.

You are a generative SERP strategist. For the following queries and current content URLs from {site_url}: {query_content_map}, identify which generative SERP features each URL is eligible for (AI Overview, AI Mode panel, featured snippet, People Also Ask, knowledge panel). For each query, specify the content changes, structured data additions, and authority signals required to achieve inclusion in the most valuable available feature...
geogenerative-serpfeatures
GEO v1.0

GEO Entity Salience Brief

Produces a content brief focused on increasing entity salience for LLM retrieval on a topic.

Act as a GEO content strategist. For the target entity {entity_name} and topic {topic}, create a content brief that maximizes entity salience for LLM retrieval. Include: the top co-occurring entities to reference, the semantic relationships to establish, the factual claims to make prominent, the ideal content structure for passage retrieval, and 3 sample passages optimized for AI Overview or Perplexity citation...
geoentity-saliencecontent-brief
Technical v1.0

Hreflang Return Tag Matrix Builder

Generates a complete hreflang tag matrix with return tags for a multi-locale site.

You are an international SEO engineer. For {site_url} with the following locale/URL mapping: {locale_url_map}, generate a complete hreflang implementation for the page template {page_template}. Include: the full set of hreflang link tags for each locale, the mandatory x-default tag, bidirectional return tags from every locale to every other locale, and the choice of implementation method (HTML head, HTTP header, or sitemap) with justification...
technicalhreflanginternational
Audit v1.0

Image SEO Coverage Sweep

Audits images across a page set for alt text, file names, format, and structured data gaps.

You are an image SEO specialist. For the following list of pages from {site_url}: {page_list}, audit every image for: (1) presence and quality of alt text, (2) descriptive vs. generic file names, (3) modern format usage (WebP/AVIF), (4) lazy-loading attributes, (5) eligible structured data (ImageObject schema). Output a per-image findings table with a severity rating and specific fix recommendation for each gap...
auditimage-seostructured-data
Ranking v1.0

Image SERP Structured Data Plan

Builds a structured data and content strategy to improve image SERP visibility for a page.

You are an image SERP optimization specialist. For {page_url} targeting the image search query {target_query}, audit the page's images against these ranking factors: alt text relevance, file name descriptiveness, surrounding text context, ImageObject schema, page authority, and loading performance. Compare against the top 5 current image SERP results and output a structured optimization plan...
rankingimage-serpstructured-data
Technical v1.0

INP Interaction Trace Fix

Diagnoses slow INP interactions from a trace and prescribes targeted JavaScript fixes.

You are a Core Web Vitals performance engineer specializing in INP. Analyze the following Chrome DevTools performance trace for {page_url}: {trace_data}. Identify the specific interactions causing INP to exceed 200ms, trace the long tasks responsible (including main thread blocking scripts, event handler duration, and rendering pipeline delays), and prescribe targeted fixes: script chunking, event delegation changes, scheduler.postTask() usage, or input debouncing...
technicalinpperformance
Audit v1.0

JS Rendering Content Gap Audit

Compares raw HTML vs. rendered DOM to find SEO content hidden behind JavaScript.

Act as a JavaScript SEO auditor. For {page_url}, compare the raw HTML source against the fully rendered DOM snapshot provided: {raw_html} vs {rendered_dom}. Identify all SEO-critical content that appears only in the rendered DOM (headings, body text, links, structured data, meta tags). Categorize findings by severity and recommend whether server-side rendering, dynamic rendering, or prerendering is the appropriate fix for each...
auditjs-renderingdom
Ranking v1.0

Keyword Cannibalization Intent Audit

Diagnoses keyword cannibalization by comparing page intent alignment, not just keyword overlap.

You are a keyword strategy specialist. For the following cannibalizing URL pairs from {site_url}: {cannibalization_pairs}, analyze each pair not just by keyword overlap but by search intent served, content depth, authority signals, and conversion goal alignment. For each pair, recommend: (a) consolidate via redirect, (b) canonicalize one to the other, (c) differentiate content to serve distinct intents, or (d) no action needed — with full reasoning...
rankingcannibalizationintent
Ranking v1.0

Knowledge Panel Entity Signal Plan

Creates an action plan to trigger and enhance a Google Knowledge Panel for a brand entity.

You are a Knowledge Panel optimization specialist. For the entity {entity_name} of type {entity_type} (e.g., Organization, Person, Product), audit the following existing entity signals: {signal_inventory}. Identify gaps in Wikidata/Wikipedia coverage, sameAs schema properties, structured data on the official site, and third-party authoritative mentions. Produce a step-by-step action plan to trigger Knowledge Panel appearance or enhance an existing panel...
rankingknowledge-panelentity
Technical v1.0

LCP Critical Path Load Fix

Traces the LCP element's resource load chain and prescribes render-critical path fixes.

Act as an LCP optimization engineer. For {page_url}, the LCP element is: {lcp_element_description}. Analyze the following waterfall data: {waterfall_data}. Trace the full resource load chain for the LCP element from initial request to render. Identify bottlenecks: render-blocking resources, missing preload hints, server response time issues, image format/size inefficiencies, and third-party script delays. Prescribe specific fixes with expected LCP improvement estimates...
technicallcpperformance
GEO v1.0

LLM Source Authority Tier Model

Models which source authority tiers LLMs prefer when answering queries in a niche.

You are an LLM source preference analyst. For the niche {industry_niche}, analyze the following set of LLM-generated answers and their cited sources: {answer_citation_data}. Classify cited sources by authority tier (T1: institutional/academic, T2: established media, T3: industry publications, T4: brand sites). Identify the tier distribution preferred per LLM and recommend what authority signals {brand_domain} should build to move up tiers...
geosource-authorityllm
Ranking v1.0

Local Pack Signal Gap Planner

Identifies the GBP and on-page signal gaps preventing a local business from ranking in the 3-pack.

Act as a local SEO specialist. For {business_name} targeting the keyword {target_keyword} in {location}, analyze the top 3 current local pack results: {competitor_data}. Compare {business_name}'s GBP profile, review count and rating, citation consistency, proximity signals, and on-page LocalBusiness schema against the pack winners. Output a ranked list of signal gaps and specific actions to close each one...
rankinglocal-packlocal-seo
Audit v1.0

Log File Segment Intent Audit

Segments Googlebot log entries by URL pattern to surface crawl intent mismatches.

You are an SEO log file analyst. Given the following log file excerpt for {site_url}, segment all Googlebot hits by URL pattern (e.g., /blog/, /product/, /category/, /tag/), then identify which segments are over-crawled relative to their traffic value, which are under-crawled, and output a prioritized list of directives to rebalance crawl allocation...
auditlog-filecrawl
Audit v1.0

Mobile-First Content Parity Check

Verifies that mobile-rendered HTML contains all SEO-critical content present on desktop.

You are a mobile-first indexing auditor. Compare the following mobile-rendered HTML and desktop-rendered HTML snapshots for {page_url}: {mobile_html} vs {desktop_html}. Identify any SEO-critical elements present on desktop but missing or truncated on mobile, including: body text, headings, structured data, internal links, image alt attributes, and canonical tags. Output a parity gap report with fix recommendations...
auditmobile-firstparity
GEO v1.0

Multi-LLM Citation Coverage Matrix

Maps which LLMs cite your brand across a topic set to expose cross-platform visibility gaps.

You are a multi-LLM visibility analyst. For the topic set {topic_list} and brand {brand_name}, I have collected citation data from ChatGPT, Claude, Perplexity, and Gemini: {citation_matrix}. Build a cross-platform citation coverage matrix showing where {brand_name} is cited, partially cited, or absent for each topic and each LLM. Identify the highest-priority gaps and the content actions most likely to close them...
geomulti-llmcitation
Audit v1.0

Orphan Page Link Priority Audit

Ranks orphaned pages by traffic potential to prioritize internal link remediation.

You are an internal link strategist. Given this list of orphan pages (pages with zero internal links) from {site_url}: {orphan_page_list}, cross-reference each URL against its estimated organic traffic and keyword rankings. Rank them by remediation priority, suggest the top 3 source pages on the site that should link to each orphan, and provide recommended anchor text for each...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Topical Gap Expander

Mines People Also Ask results to surface topical gaps and new ranking opportunities.

Act as a SERP research analyst. For the seed keyword {seed_keyword}, I have collected the following PAA questions across 3 levels of expansion: {paa_data}. Cluster these questions by sub-topic, identify which clusters have no existing content on {site_url}, and prioritize them by search intent value and estimated traffic opportunity. Output a prioritized gap list with recommended page types for each cluster...
rankingpaatopical-gap
GEO v1.0

Perplexity Citation Competitor Gap

Identifies which competitor pages Perplexity cites for target queries you are not cited for.

You are a GEO analyst specializing in Perplexity AI. For the following target queries: {query_list}, I have collected Perplexity answer outputs and their cited sources: {citation_data}. Identify which domains are cited most frequently, which queries cite competitors but not {brand_domain}, and what content characteristics the cited pages share. Produce a gap report and content recommendations to improve citation eligibility...
geoperplexitycitation-gap
Technical v1.0

Prerender Eligibility Config Builder

Determines prerendering eligibility for each page type and writes the required configuration.

Act as a rendering SEO architect. For {site_url} with the following page templates: {template_list}, evaluate each template's suitability for prerendering based on: content dynamism, personalization requirements, authentication gates, JavaScript dependency complexity, and crawl priority. For eligible templates, write the prerendering configuration for {prerender_service} including URL patterns, caching TTL, bot detection rules, and cache invalidation triggers...
technicalprerenderingrendering
Content v1.0

Programmatic SEO Content Template

Builds a scalable content template for programmatic page generation with uniqueness safeguards.

Act as a programmatic SEO architect. For the page type {page_type} targeting the pattern {url_pattern} on {site_url}, create a content template that scales across {variable_count} variable combinations. For each section, specify: the dynamic variable to inject, the static content wrapper ensuring uniqueness, the minimum content depth requirement, the schema type to apply, and the internal link logic. Include a duplicate content risk checklist...
contentprogrammatic-seotemplate
Technical v1.0

Robots.txt Crawl Budget Engineer

Writes optimized robots.txt directives to protect crawl budget for high-value page segments.

You are a technical SEO engineer. For {site_url}, given the following site architecture and crawl data: {site_architecture} and {crawl_data}, write an optimized robots.txt file that: (1) disallows low-value URL patterns (facets, session IDs, print pages, internal search), (2) preserves crawl access to all money pages and key content templates, (3) explicitly references the XML sitemap(s), and (4) includes per-bot directives where Googlebot and Bingbot require different rules. Annotate each directive...
technicalrobots-txtcrawl-budget
Technical v1.0

Schema Markup Type Generator

Generates production-ready JSON-LD schema markup for a specified page type and content.

Act as a structured data engineer. For the following page content from {page_url}: {page_content}, generate complete, valid JSON-LD schema markup using the most appropriate Schema.org type(s): {schema_types}. Include all recommended properties, nest related types correctly (e.g., Organization > ContactPoint, Article > Author > Person), follow Google's structured data guidelines, and annotate each property with a brief comment explaining its SEO purpose...
technicalschemajson-ld
Audit v1.0

Schema Type Coverage Audit

Identifies missing or misapplied schema types across key page templates for a site.

Act as a structured data specialist. Review the following list of page templates for {site_url}: {template_list}. For each template, identify (a) which schema types are currently implemented, (b) which eligible schema types are missing, and (c) any schema properties that are present but misconfigured. Output a gap table with recommended schema types and their highest-value properties per template...
auditschemastructured-data
Ranking v1.0

SERP Intent Volatility Map

Maps SERP intent shifts over time for a keyword set to forecast ranking instability.

Act as a SERP analyst. For the following keywords: {keyword_list}, analyze SERP snapshots from the past 90 days: {serp_snapshot_data}. Identify where the dominant SERP intent (informational, navigational, commercial, transactional) has shifted, quantify the volatility score per keyword, and recommend which target pages need intent realignment and what content adjustments would stabilize rankings through future intent shifts...
rankingintentvolatility
Technical v1.0

Security Headers SEO Risk Audit

Audits HTTP security headers for misconfigurations that negatively impact SEO crawling.

You are a technical SEO and web security specialist. For {site_url}, analyze the following HTTP response headers: {header_data}. Identify security header misconfigurations that create SEO risks: CSP directives blocking Googlebot-accessible resources, overly restrictive X-Robots-Tag headers, HSTS settings causing redirect loops, or missing security headers that reduce trust signals. For each issue, provide the corrected header value and explain the SEO impact...
technicalsecurity-headersseo-risk
Ranking v1.0

Shopping SERP Feed Gap Optimizer

Identifies product feed attribute gaps that reduce Shopping SERP impression share.

Act as a Shopping SERP optimization specialist. Review the following Google Merchant Center product feed excerpt for {site_url}: {feed_data}. Identify missing or low-quality attributes (title structure, GTINs, image quality, product descriptions, price accuracy, availability, custom labels) that are limiting Shopping SERP eligibility or Quality Score. For each gap, provide the specific fix and its expected impact on impression share...
rankingshopping-serpfeed
Audit v1.0

Technical Site Health Scorecard

Generates a weighted scorecard across 12 technical SEO dimensions for a given site.

Act as a senior technical SEO auditor. For {site_url}, evaluate and score (0–10) each of these 12 dimensions: crawlability, indexability, page speed, mobile usability, structured data, canonicalization, internal linking, redirect health, security headers, hreflang, log file signals, and JS rendering. Return a weighted total score, a per-dimension verdict, and the top 3 priority fixes...
audittechnicalscorecard
Content v1.0

Title Meta Batch CTR Optimizer

Rewrites a batch of title tags and meta descriptions to improve click-through rate signals.

You are a CTR optimization specialist. For the following list of pages from {site_url}: {page_data} (each with current title, meta description, primary keyword, and average SERP position), rewrite each title tag and meta description to: include the primary keyword naturally, add a compelling differentiator, match the search intent precisely, stay within character limits (60 chars title, 155 chars meta), and improve emotional or utility triggers. Return a before/after table...
contentctrmeta-tags
Content v1.0

Topic Cluster Hub Content Planner

Designs the hub page content strategy for a topic cluster, including spoke link architecture.

You are a topic cluster architect. For the pillar topic {pillar_topic} on {site_url}, design the hub (pillar) page content strategy. Specify: the target keyword and intent, recommended sections with H2/H3 structure, each spoke page to internally link to with anchor text, the entities and concepts the hub must cover for topical authority, the schema markup types to implement, and the ideal content depth to outcompete {competitor_list}'s hub pages...
contenttopic-clusterhub-page
Technical v1.0

XML Sitemap Segment Priority Builder

Engineers a segmented XML sitemap architecture with priority and changefreq logic.

Act as a technical SEO architect. For {site_url} with {total_url_count} indexable URLs, design a segmented XML sitemap architecture. Specify: how to split sitemaps by content type (articles, products, categories, landing pages), the correct priority and changefreq values for each segment based on update frequency and business value, the sitemap index structure, the submission strategy in GSC, and any hreflang or image sitemap extensions needed...
technicalsitemaparchitecture
GEO v1.0

AI Overview Passage Depth Planner

Plans passage-level content depth improvements to increase eligibility for AI Overview citations.

For the target query '{query}', analyse the AI Overview currently shown and identify which content depth signals (definition, comparison, step-by-step, evidence) are present in cited sources but absent from {page_url}. Output a passage rewrite plan...
geoai-overviewpassage-optimization
Content v1.0

Anchor Text Diversity Gap Plan

Audits internal anchor text distribution for over-optimisation and builds a diversification plan.

Analyse the internal anchor text report below for {page_url}. Identify over-used exact-match anchors, missing contextual anchor variations, and pages that link to the target with generic text. Output a diversification plan with recommended anchor text variants for each linking page: {anchor_text_data}
contentanchor-textinternal-links
GEO v1.0

Brand Mention Context Gap Audit

Audits the context in which a brand is mentioned online and identifies gaps vs. desired associations.

Analyse the following brand mention data for {brand_name} across forums, news, and review sites. Identify which topical contexts the brand is mentioned in, which desired contexts are absent, and what content or PR actions would close the gap: {mention_data}
geobrand-mentionsentity
Audit v1.0

Canonical Loop Conflict Detector

Detects canonical chains, loops, and self-referencing conflicts across paginated or parameterised URLs.

Review the canonical tag data exported below for {site_url}. Identify any canonical chains longer than one hop, self-contradicting canonicals, canonical loops, and pages where the canonical disagrees with the redirect target. Output a prioritised fix list: {canonical_data}
auditcanonicalduplicate-content
GEO v1.0

ChatGPT Entity Citation Readiness Scorer

Scores a brand's entity signals for readiness to be cited by ChatGPT browsing on target queries.

Evaluate the entity readiness of {brand_name} for ChatGPT citation on the topic '{topic}'. Assess Wikipedia presence, third-party mentions, structured data, and on-page entity clarity. Score each signal 1–5 and provide a prioritised improvement plan...
geochatgptentity
GEO v1.0

Citation Signal Pre-Publish Optimizer

Reviews a draft article against LLM citation preference signals before publication.

Review the following draft article intended to attract LLM citations for the topic '{topic}'. Evaluate it against citation preference signals: factual density, entity salience, structured passages, author authority, and external references. Provide a scored checklist and rewrite suggestions: {draft_content}
geocitationspre-publish
Ranking v1.0

Competitor Content Gap Rank Planner

Identifies keywords where competitors rank in positions 1–10 but the target site has no ranking page.

Using the keyword ranking exports below for {site_url} and competitors {competitor_list}, identify all keywords where at least two competitors rank in positions 1–10 and {site_url} has no ranking URL. Group by topic cluster, estimate traffic opportunity, and recommend page creation priority: {ranking_data}
rankingcompetitorcontent-gaps
Content v1.0

Content Gap Cluster Opportunity Scorer

Scores content gap opportunities by cluster volume, competition, and topical authority alignment.

Using the content gap data below comparing {site_url} against {competitor_list}, group missing topics into clusters. For each cluster, score opportunity using: total search volume, average keyword difficulty, {site_url}'s existing topical authority, and monetisation alignment. Output a prioritised cluster backlog: {gap_data}
contentcontent-gapsopportunity
Content v1.0

Content Refresh Decay Prioritizer

Scores a content inventory for refresh priority based on traffic decay rate and ranking position loss.

Analyse the content performance data below for {site_url}. For each URL, calculate the traffic decay rate over the past {n} months, ranking position change, and backlink trend. Score each page 1–10 for refresh urgency and output a prioritised refresh roadmap: {content_performance_data}
contentcontent-refreshdecay
GEO v1.0

Generative SERP Source Preference Tracker

Tracks which domains generative SERP features prefer over time for a defined topic set.

Over {n} weekly snapshots, record the sources cited in AI Overviews and AI Mode responses for the query set {query_list}. Identify domain citation frequency trends, new entrants, and domains that lost citations. Output a drift report with hypotheses...
geogenerative-serpsource-tracking
Content v1.0

FAQ Intent Block Generator

Generates schema-ready FAQ blocks aligned to PAA and long-tail intent for a target page.

For the target page {page_url} covering the topic '{topic}', generate 8 FAQ items sourced from People Also Ask data, search suggestions, and forum questions. Each FAQ must include a question, a 40–60 word answer, and FAQPage schema markup...
contentfaqschema
Audit v1.0

Hreflang Return Tag Gap Audit

Validates that every hreflang tag has a reciprocal return tag across all locale variants.

Analyse the hreflang implementation data below for {site_url}. For each locale URL pair, verify that a correct reciprocal return tag exists. List all missing or mismatched return tags and provide corrected hreflang markup: {hreflang_data}
audithreflanginternational
Technical v1.0

Hreflang XML Config Validator

Validates hreflang XML sitemap entries for correct locale codes, return tags, and URL consistency.

Validate the hreflang entries in the XML sitemap extract below for {site_url}. Check each entry for: valid ISO language-region codes, presence of x-default, reciprocal return tags, and consistency with canonical URLs. Output a line-by-line error report with corrected markup: {sitemap_extract}
technicalhreflangsitemap
Audit v1.0

Indexing Coverage Gap Report

Diagnoses GSC indexing coverage errors and maps each issue to a specific technical root cause.

Review the Google Search Console indexing coverage export below for {site_url}. For each non-indexed URL group, diagnose the most likely technical root cause, assign a severity level (critical/high/medium), and recommend a fix: {gsc_coverage_export}
auditindexinggsc
Technical v1.0

INP Interaction Trace Fix Plan

Diagnoses INP delays from interaction traces and outputs JavaScript optimisation tasks.

Analyse the Chrome DevTools Performance panel trace below for {page_url}. Identify the interaction events contributing to high INP (input delay, processing time, presentation delay). For each bottleneck, specify the JavaScript optimisation task (code splitting, long task breaking, event handler debouncing): {trace_data}
technicalinpcore-web-vitals
Audit v1.0

Internal Link Depth Gap Audit

Flags high-value pages buried too deep in the internal link graph relative to their importance.

Using the crawl depth report and page-level organic traffic data below for {site_url}, identify pages with high traffic potential that sit beyond {max_depth} clicks from the homepage. Recommend internal linking changes to reduce their depth: {crawl_depth_data}
auditinternal-linkscrawl
Ranking v1.0

Knowledge Panel Attribute Gap Plan

Identifies missing or incorrect Knowledge Panel attributes for a brand and plans structured data fixes.

Audit the Google Knowledge Panel currently shown for '{entity_name}'. List all attributes displayed, identify attributes that are incorrect or absent (e.g. founding date, headquarters, social profiles), and recommend the structured data and third-party sources needed to populate or correct each...
rankingknowledge-panelentity
Technical v1.0

LCP Resource Load Chain Optimizer

Traces the LCP element's resource load chain and outputs specific optimisation directives to reduce LCP time.

Using the WebPageTest or CrUX waterfall data below for {page_url}, identify the LCP element and trace its full resource load chain (DNS, connection, TTFB, resource load). For each bottleneck in the chain, provide a specific technical fix with expected LCP time saving: {waterfall_data}
technicallcpcore-web-vitals
GEO v1.0

LLM Source Authority Signal Auditor

Audits the authority signals on a page that influence whether LLMs select it as a source.

Evaluate {page_url} for the signals that large language models use to assess source authority: author credentials, publication date, citation count, linked references, factual density, and entity clarity. Score each factor and recommend improvements...
geoauthorityllm
Ranking v1.0

Local Pack Competitor Signal Matrix

Builds a competitive signal matrix for local pack rankings across review count, proximity, and categories.

For the local pack results appearing for '{query}' in {location}, extract the top 3 ranking competitors. For each, record: GBP category, review count, average rating, review recency, citation count, and website on-page signals. Output a gap matrix for {brand_name}...
rankinglocal-packcompetitor
Audit v1.0

Log File Segment Pattern Audit

Analyzes server log files to surface Googlebot crawl patterns by URL segment and frequency.

Given the exported server log data below for {site_url}, segment Googlebot requests by URL path pattern, calculate crawl frequency per segment, identify over-crawled low-value paths, and recommend robots.txt or crawl-rate adjustments: {log_data}
auditlog-filecrawl
Audit v1.0

Mobile-First Gap Diagnostics

Checks mobile vs desktop render parity to surface content or resource discrepancies for mobile-first indexing.

Compare the mobile and desktop rendered HTML snapshots below for {page_url} and identify any discrepancies in content, structured data, internal links, or meta tags that could disadvantage the page under mobile-first indexing: {mobile_html} {desktop_html}
auditmobile-firstrendering
GEO v1.0

Multi-LLM Answer Variance Tester

Tests the same query across multiple LLMs and compares brand mention and citation variance.

Submit the query '{query}' to ChatGPT, Claude, Gemini, and Perplexity. Record the full response from each. Identify: (a) whether {brand_name} is mentioned, (b) the sentiment of any mention, (c) which sources are cited, and (d) factual discrepancies across models...
geomulti-llmbrand-mentions
Audit v1.0

Orphan Page Link Path Finder

Identifies orphaned URLs with no internal links and recommends the most logical link entry points.

Using the crawl export and internal link map below for {site_url}, identify all URLs receiving zero internal links. For each orphan URL, recommend the three most contextually relevant pages that should link to it, and suggest anchor text: {crawl_export}
auditorphan-pagesinternal-links
Ranking v1.0

PAA Intent Depth Expander

Expands People Also Ask trees for a seed query and maps each node to a content or FAQ opportunity.

Starting from the seed query '{seed_query}', map the full People Also Ask tree to a depth of 3 levels. For each question node, classify its intent, estimate its content opportunity (new page vs. FAQ addition vs. section expansion), and suggest a 40–60 word answer format...
rankingpaacontent-gaps
GEO v1.0

Perplexity Citation Competitor Profiler

Profiles which competitor domains Perplexity cites most for a topic and surfaces their shared content signals.

Run the following {n} queries related to {topic} in Perplexity AI and record all cited sources. Group citations by domain, calculate citation frequency, and identify the content format, word count, and structural signals most common among top-cited pages...
geoperplexitycitations
Content v1.0

Programmatic Content Template Spec

Designs a programmatic content template spec for scalable page generation across a defined entity type.

Design a programmatic content template for {site_url} targeting the entity type '{entity_type}'. Specify the required data fields, dynamic content blocks, static editorial sections, internal linking logic, schema types, and quality thresholds each generated page must meet...
contentprogrammatictemplates
Audit v1.0

Redirect Chain Consolidation Mapper

Maps multi-hop redirect chains and outputs a consolidated single-hop redirect plan.

Analyse the following redirect chain data for {site_url} and identify all chains longer than one hop. For each chain, output: source URL, chain depth, final destination, and a recommended single-hop replacement rule: {redirect_data}
auditredirectscrawl
Content v1.0

Schema-Rich How-To Content Spec

Produces a how-to article spec with embedded HowTo schema structure for rich result eligibility.

Write a full content spec for a how-to article on '{topic}' for {site_url}. Include a recommended title, step-by-step outline (5–10 steps), estimated time and tool requirements, and complete HowTo schema markup in JSON-LD with one image recommendation per step...
contenthow-toschema
Technical v1.0

Security Headers CSP SEO Risk Spec

Audits Content Security Policy headers for directives that may block Googlebot or third-party SEO scripts.

Review the HTTP response headers below for {site_url} and evaluate the Content-Security-Policy configuration for SEO risk. Identify any directives that could block Googlebot from rendering JavaScript, third-party structured data scripts, or analytics tags. Output a revised CSP with SEO-safe directives: {response_headers}
technicalsecurity-headerscsp
Ranking v1.0

SERP Volatility Root Cause Diagnosis

Diagnoses the root cause of SERP ranking volatility for a URL using rank history and algorithm update timelines.

Using the rank tracking data below for {page_url} on the query '{query}', correlate ranking drops and recoveries with known Google algorithm update dates. Classify the likely update type responsible (core, helpful content, spam, etc.) and recommend targeted remediation: {rank_history_data}
rankingvolatilityalgorithm
Ranking v1.0

Shopping SERP Feed Gap Analyzer

Compares a product feed against top shopping SERP competitors to identify attribute and content gaps.

Compare the product feed extract below for {brand_name} against the top 5 Shopping SERP results for '{query}'. Identify gaps in: title structure, price competitiveness, GTIN presence, image quality, review count, and shipping attributes. Prioritise fixes by estimated impression impact: {feed_extract}
rankingshopping-serpproduct-feed
Audit v1.0

Technical Site Crawl Framework

Generates a structured technical site audit framework covering all core crawlability signals.

Act as a senior technical SEO. For the site {site_url}, produce a full technical crawl audit framework covering crawlability, indexability, redirect health, structured data, and Core Web Vitals. Prioritise findings by impact and assign remediation owners...
auditcrawltechnical
Content v1.0

Title Meta SERP CTR Rewriter

Rewrites title tags and meta descriptions for low-CTR pages using GSC data and SERP competitor analysis.

Using the GSC CTR data below, identify pages for {site_url} with impressions above {impression_threshold} but CTR below {ctr_threshold}%. For each page, analyse competing SERP titles and rewrite the title tag and meta description to improve click-through rate: {gsc_ctr_data}
contentctrmeta
Content v1.0

Topic Cluster Hub-Spoke Map

Builds a hub-and-spoke topic cluster map with pillar and supporting page assignments for a seed topic.

For the seed topic '{topic}', design a hub-and-spoke content cluster for {site_url}. Identify one pillar page topic, 8–12 supporting spoke page topics, the search intent for each spoke, recommended internal linking paths, and estimated keyword opportunity for each node...
contenttopic-clustercontent-planning
Ranking v1.0

Video SERP Schema Opportunity Planner

Identifies video SERP opportunities for a topic set and maps VideoObject schema requirements.

For the topic '{topic}', identify queries that currently show video carousels in Google SERP. For each query, specify the optimal video duration, thumbnail format, title structure, and VideoObject schema properties required to compete for a video SERP position...
rankingvideo-serpschema
Technical v1.0

XML Sitemap Index Locale Architect

Designs a sitemap index structure split by locale, content type, and update frequency.

Design a sitemap index architecture for {site_url} with {n} locale variants and the following content types: {content_types}. Specify the sitemap index file structure, individual sitemap file split logic, priority and changefreq values, and news sitemap configuration if applicable...
technicalsitemapinternational
GEO v1.0

AEO Topical Coverage Gap Finder

Finds topical sub-questions a site fails to answer that AI engines use to disqualify it as a source.

For the topic '{main_topic}' and domain {site_url}, generate the 20 most common sub-questions an AI answer engine would need answered to consider the site a comprehensive authority. Cross-reference against existing site content, identify coverage gaps, and produce a prioritized content creation plan to fill them...
geoaeotopical-authority
GEO v1.0

Brand Mention Context Optimizer

Audits the sentiment and context of brand mentions in LLM outputs and recommends corrective content actions.

Review the following LLM-generated responses that mention {brand_name}: {llm_outputs}. Classify each mention by sentiment (positive/neutral/negative), context accuracy, and association strength. Identify misrepresentations or weak associations, then recommend specific content and entity actions to shift the brand context toward '{desired_positioning}'...
geobrand-mentionsentiment
Audit v1.0

Canonical Conflict Signal Auditor

Detects canonical tag conflicts, self-referencing errors, and chain canonicals across a crawl export.

Review the following canonical tag data from a crawl of {site_url}: {canonical_data}. Identify conflicting canonicals (page A canonicalizes to B while B canonicalizes to A), non-self-referencing canonicals on indexable pages, chains of three or more hops, and any canonical/noindex contradictions. Output a resolution plan for each conflict type...
auditcanonicalindexing
Technical v1.0

CDN Cache SEO Header Config

Configures CDN cache-control and Vary headers to ensure Googlebot receives correctly cached responses.

Produce a CDN cache configuration spec for {cdn_provider} serving {site_url} that ensures Googlebot receives correct, non-stale responses. Define Cache-Control directives per content type ({content_types}), configure Vary headers for mobile/desktop serving differences, specify cache invalidation rules for content updates, and flag any current header configurations in {current_config} that could cause Googlebot to receive stale or incorrect content...
technicalcdncaching
Content v1.0

Content Decay Traffic Recovery Plan

Diagnoses traffic-declining pages and builds a refresh action plan ranked by recovery potential.

Analyze the following pages from {site_url} that have lost more than 20% organic traffic over the past six months: {decaying_pages}. For each page, diagnose the likely decay cause (freshness, SERP intent shift, competitor content improvement, link decay). Produce a refresh action plan for each page with specific content, structural, and promotional actions ordered by recovery potential...
contentcontent-decayrefresh
Content v1.0

E-E-A-T Author Signal Optimizer

Audits author bio and page credibility signals against E-E-A-T criteria and recommends enhancements.

Review the author bio, credentials section, and on-page trust signals for {author_name} on {site_url}. Score each E-E-A-T dimension (Experience, Expertise, Authoritativeness, Trustworthiness) on a 1–5 scale with justification. Produce a specific enhancement plan for each dimension including schema markup, bio copy rewrites, and off-page authority actions...
contente-e-a-tauthor
Content v1.0

FAQ Content Block Generator

Generates FAQ content blocks with PAA-aligned questions and schema-ready answers for a target topic.

Generate a FAQ content block for the page targeting '{target_keyword}' on {site_url}. Include 8–10 questions drawn from People Also Ask data and forum research for this topic. For each question, write a concise answer (40–60 words) optimized for featured snippet extraction, and output the complete FAQPage JSON-LD schema block to accompany the content...
contentfaqschema
GEO v1.0

ChatGPT Entity Mention Readiness

Assesses how prominently a brand entity appears in ChatGPT responses and what signals drive inclusion.

Run the following 10 brand-adjacent queries in ChatGPT and record whether {brand_name} is mentioned, how prominently, and in what context: {query_list}. Analyze the pattern of inclusion/exclusion and produce a prioritized entity signal improvement plan to increase ChatGPT mention frequency...
geochatgptentity
GEO v1.0

Generative SERP Passage Targeting

Maps which content passages on a page are most likely to surface in generative SERP features.

For the page at {page_url} targeting the query cluster '{query_cluster}', analyze each content section and score its generative SERP retrieval likelihood based on: answer completeness, semantic density, structural clarity, and entity specificity. Rewrite the three lowest-scoring sections to improve passage retrieval odds...
geogenerative-serppassage
Ranking v1.0

Featured Snippet Format Gap Plan

Identifies queries where a site ranks in positions 2–5 and maps the snippet format needed to claim position zero.

For the following keywords where {site_url} ranks in positions 2–5: {keyword_list}, identify the current featured snippet format (paragraph, list, table, code) for each. Produce a content reformatting plan specifying the exact structural changes needed on each ranking page to contest the featured snippet...
rankingfeatured-snippetserp
Audit v1.0

Hreflang Return Tag Gap Report

Scans an hreflang implementation for missing return tags across locale pairs and outputs a fix matrix.

Analyze the following hreflang tag inventory for {site_url} across all locale variants: {hreflang_data}. Identify every locale pair missing a reciprocal return tag, flag x-default misconfigurations, and produce a fix matrix showing the exact hreflang tags needed for each affected URL...
audithreflanginternational
Technical v1.0

Hreflang XML Sitemap Locale Config

Generates a complete hreflang XML sitemap configuration for a multi-locale site with all return tags.

Generate a complete hreflang XML sitemap configuration for {site_url} covering the following locale and URL pairs: {locale_url_data}. Ensure every URL includes hreflang annotations for all locale variants plus an x-default entry, all return tags are present and reciprocal, and the output is formatted as a valid XML sitemap ready for Google Search Console submission...
technicalhreflangsitemap
Ranking v1.0

Image SERP Structured Data Gap

Identifies image pages lacking structured data and metadata needed to improve Image SERP rankings.

Analyze the image assets and associated page metadata for {site_url} targeting the visual query cluster '{image_topic}'. For each image, flag missing or weak signals including alt text specificity, surrounding text relevance, ImageObject schema, and page topical authority. Produce a prioritized optimization plan for Image SERP visibility...
rankingimage-serpstructured-data
Content v1.0

Internal Link Insertion Recommender

Recommends specific internal link insertions and anchor text for a target page to boost topical authority.

Given the target page at {target_url} on {site_url} and the following list of related existing pages: {related_pages}, recommend the 10 highest-value internal link insertion opportunities. For each recommendation specify: the source page URL, the exact sentence or paragraph where the link should be inserted, and the recommended anchor text with justification...
contentinternal-linksanchor-text
Technical v1.0

JSON-LD Schema Validator Brief

Validates a JSON-LD schema block against Google's rich result requirements and outputs a fix report.

Validate the following JSON-LD schema block from {page_url} against Google's current rich result requirements for the {schema_type} type: {json_ld_block}. Identify all errors (missing required properties, incorrect data types, invalid enum values) and warnings (recommended missing properties). Output a corrected JSON-LD block with inline comments explaining each change...
technicalschemajson-ld
Technical v1.0

INP Interaction Trace Fix Guide

Diagnoses high INP scores using interaction traces and produces a targeted JavaScript optimization plan.

Analyze the following Chrome DevTools interaction traces and Web Vitals INP field data for {page_url}: {trace_data}. Identify the specific event handlers, long tasks, and rendering work contributing to INP above 200ms. For each bottleneck, produce a targeted fix recommendation covering input delay reduction, processing time optimization, and presentation delay improvements...
technicalinpcore-web-vitals
Ranking v1.0

Knowledge Panel Attribute Gap Audit

Compares a brand's knowledge panel attributes against competitors to identify missing entity signals.

Compare the Google Knowledge Panel attributes currently displayed for {brand_name} against those shown for {competitor_list}. Identify attributes present for competitors but absent or incorrect for {brand_name} (e.g., founding date, key people, social profiles, category). Produce a structured data and entity signal action plan to close each gap...
rankingknowledge-panelentity
GEO v1.0

LLM Recency Content Gap Plan

Identifies content topics where LLM training recency gaps create opportunities for fresh-content citations.

For the topic area '{topic}' in the {industry} sector, identify where LLM responses contain outdated information (post-2023 developments not reflected). For each recency gap, draft a content update brief for {site_url} that positions the page to be cited by LLMs with real-time retrieval capabilities like Perplexity and AI Mode...
georecencyfreshness
Ranking v1.0

Local Pack Citation Signal Audit

Audits NAP consistency, citation volume, and GBP signals for local pack ranking improvement.

Audit the local pack ranking factors for {business_name} in {target_location} for the keyword '{target_keyword}'. Compare NAP consistency across top citation sources against the top three local pack competitors, flag GBP attribute gaps, and produce a citation and GBP optimization roadmap ranked by local ranking impact...
rankinglocal-seocitations
Audit v1.0

Log File Crawl Segment Report

Analyzes server log data to surface Googlebot crawl patterns and wasted crawl budget by segment.

Using the following server log data for {site_url}, segment Googlebot activity by URL type (product, category, facet, pagination). Identify over-crawled low-value segments and under-crawled high-value URLs, then recommend crawl budget reallocation actions...
auditlog-filecrawl-budget
Audit v1.0

Mobile Indexing Content Parity Check

Compares desktop vs. mobile-rendered HTML to detect content, link, or structured-data parity issues.

Given the following desktop and mobile rendered HTML snapshots for {url_list} on {site_url}, identify all instances where content, internal links, structured data, or metadata are present on desktop but absent or truncated on mobile. Output a parity gap table with severity ratings and fix recommendations...
auditmobile-firstrendering
Audit v1.0

Orphan Page Internal Link Gap

Detects orphaned pages with no internal links and recommends link insertion points to restore equity flow.

Given the following crawl export from {site_url} with inlink counts per URL: {crawl_data}, identify all pages with zero internal inlinks (orphans). For each orphan, suggest the three most contextually relevant existing pages from which an internal link should be added, with recommended anchor text...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Question Intent Cluster Map

Extracts and clusters People Also Ask questions by intent to find content expansion opportunities.

Collect all People Also Ask questions surfaced for the seed keywords {keyword_list} in the {target_market} market. Cluster the questions by intent type and sub-topic. For each cluster, identify whether {site_url} has existing content that answers the questions, flag gaps, and recommend new content or FAQ additions ordered by search volume potential...
rankingpaacontent-gaps
GEO v1.0

Perplexity Source Selection Profile

Profiles which source attributes cause Perplexity to prefer competitor domains over yours for a topic.

For the topic '{topic}' in the {industry} vertical, compare the following cited sources in Perplexity responses: {source_list}. Identify the common structural, authority, and content attributes that distinguish cited sources from non-cited ones, then produce a gap-closing action plan for {target_domain}...
geoperplexitycitation
Technical v1.0

Prerender Eligibility Config Audit

Evaluates a site's prerendering setup and identifies configuration issues preventing search-bot eligibility.

Evaluate the prerendering configuration for {site_url} using the following setup details: {prerender_config}. Determine whether the current prerender service correctly serves pre-rendered HTML to Googlebot while delivering the SPA to users. Identify configuration gaps (incorrect bot detection, stale cache TTLs, missing JavaScript execution, incomplete DOM rendering) and produce a remediation spec with priority order...
technicalprerenderingrendering
Content v1.0

Programmatic Content Template Builder

Creates a scalable programmatic content template with dynamic variables for location or category pages.

Design a programmatic content template for {page_type} pages on {site_url} targeting the pattern '{keyword_pattern}'. Define all dynamic variables (e.g., {city}, {service}, {stat}), write static and dynamic content sections, specify minimum unique content requirements per page, include schema markup slots, and flag which sections require human editorial review before publication...
contentprogrammatictemplate
Audit v1.0

Redirect Chain Consolidation Finder

Parses a redirect inventory and identifies chains longer than one hop that should be collapsed.

Analyze the following redirect map for {site_url}: {redirect_csv}. Identify all chains of two or more hops, calculate cumulative PageRank dilution risk, and output a consolidation plan that collapses each chain to a single 301 pointing directly to the final destination...
auditredirectscrawl
Technical v1.0

Robots.txt Crawl Directive Spec

Generates a complete robots.txt file with optimized directives for crawl budget and bot management.

Generate a production-ready robots.txt file for {site_url}, a {site_type} site with the following URL patterns to block from crawling: {block_patterns}. Include separate directives for Googlebot, Bingbot, and generic crawlers. Add a Sitemap reference line, block all faceted navigation parameters, and include comments explaining the purpose of each directive group...
technicalrobots-txtcrawl
Content v1.0

Schema-Rich How-To Content Builder

Drafts a How-To article with embedded HowTo JSON-LD schema optimized for rich result eligibility.

Write a How-To article for the topic '{how_to_topic}' targeting the keyword '{target_keyword}' on {site_url}. Structure the article with a clear intro, 5–8 numbered steps each containing a step name, description, and optional image recommendation. Append a complete HowTo JSON-LD schema block aligned to the article steps and optimized for Google rich result eligibility...
contenthow-toschema
Ranking v1.0

SERP Intent Mismatch Classifier

Classifies keywords where the current ranking page's intent does not match dominant SERP intent signals.

Analyze the following keyword list and their currently ranking URLs for {site_url}: {keyword_url_pairs}. For each keyword, classify the dominant SERP intent (informational, navigational, commercial, transactional) and compare it to the ranking page's content intent. Flag intent mismatches and recommend page type or content pivots to align with SERP signals...
rankingintentserp
Ranking v1.0

SERP Volatility Root Cause Mapper

Correlates ranking fluctuations with algorithm signals to diagnose the root cause of SERP volatility.

Given the following ranking history data for {site_url} across {keyword_count} keywords over the past 90 days: {ranking_data}, correlate volatility spikes with known Google algorithm update dates, site change logs, and SERP feature changes. Classify each volatility event by likely cause (content quality, link, technical, SERP feature change) and recommend stabilization actions...
rankingvolatilityalgorithm
Technical v1.0

Server-Side Rendering SEO Spec

Produces an SSR configuration spec ensuring critical SEO metadata is rendered server-side, not client-side.

Produce a server-side rendering SEO configuration spec for the {framework} application at {site_url}. Define which metadata elements (title, canonical, hreflang, OG tags, structured data, pagination links) must be SSR-rendered rather than client-side injected, specify the rendering pipeline requirements, and flag any current components identified in {component_list} that violate SSR requirements...
technicalssrrendering
Ranking v1.0

Shopping SERP Feed Gap Analysis

Audits a product feed for attribute gaps that suppress Shopping SERP impressions and click share.

Analyze the following Google Merchant Center product feed excerpt for {site_url}: {feed_data}. Identify missing or low-quality attributes (title keyword structure, GTIN, product type taxonomy, description length, image quality signals) that reduce Shopping SERP eligibility. Produce an attribute-by-attribute improvement plan sorted by estimated impression impact...
rankingshopping-serpproduct-feed
GEO v1.0

Source Authority Signal Builder

Identifies the off-page and structural authority signals that increase LLM source preference for a domain.

Analyze the following domains that are consistently cited by LLMs for the topic cluster '{topic_cluster}': {cited_domains}. Identify the shared authority signals (backlink profiles, structured data types, author credentials, publication frequency) that distinguish them. Produce an authority-signal roadmap for {target_domain} to match those patterns...
geosource-authorityllm
Audit v1.0

Technical Site Audit Checklist

Generates a prioritized technical site audit checklist based on site type and known issues.

Act as a senior SEO engineer. Generate a prioritized technical site audit checklist for {site_url}, a {site_type} site. For each item include severity (critical/high/medium/low), diagnostic method, and recommended fix...
audittechnicalchecklist
Content v1.0

Title Meta Batch CTR Rewriter

Rewrites title tags and meta descriptions in bulk to improve CTR based on SERP behavior patterns.

Rewrite the title tags and meta descriptions for the following pages on {site_url}: {page_list}. For each page, apply CTR optimization principles: front-load the primary keyword, add a power word or number where natural, keep titles under 60 characters and descriptions under 155 characters, and match the dominant SERP intent. Output in a table with old vs. new versions...
contenttitle-tagsctr
Content v1.0

Topic Cluster Hub-Spoke Builder

Designs a hub-and-spoke topic cluster architecture with spoke page briefs for a target topic.

Design a complete hub-and-spoke topic cluster for the pillar topic '{pillar_topic}' targeting the {target_audience} audience on {site_url}. Define the hub page scope, identify 8–12 spoke page topics with target keywords, specify internal linking structure between hub and spokes, and produce a one-paragraph content brief for each spoke page...
contenttopic-clusterarchitecture
Ranking v1.0

Video SERP Markup Optimizer

Generates a VideoObject schema and page optimization plan to improve video SERP rich-result eligibility.

For the video content at {video_url} on {site_url} targeting the query '{target_query}', generate a complete VideoObject JSON-LD schema block, audit the surrounding page copy for relevance signals, and produce a five-point on-page optimization checklist to maximize Video SERP rich result eligibility and thumbnail appearance...
rankingvideo-serpschema
Technical v1.0

XML Sitemap Index Architecture

Designs a scalable XML sitemap index structure with sub-sitemaps segmented by page type and priority.

Design a complete XML sitemap index architecture for {site_url}, which has approximately {page_count} indexable pages across the following content types: {content_types}. Specify the sitemap index file structure, individual sub-sitemap segmentation logic, changefreq and priority settings per content type, and a recommended submission and update frequency schedule in Google Search Console...
technicalsitemapcrawl
GEO v1.0

Brand Mention Gap Context Audit

Audits the context in which a brand is mentioned across the web to identify negative or missing LLM signals.

You are a brand GEO analyst. Using the following mention data for {brand_name}, classify each mention by sentiment, topical context, and co-citation partners. Identify contexts where the brand is missing, misrepresented, or weakly associated, and recommend outreach or content strategies to strengthen the signal...
geobrand-mentioncitation
GEO v1.0

ChatGPT Entity Readiness Scorer

Scores how well a brand's entity signals prepare it to be cited accurately by ChatGPT for target queries.

Act as a GEO entity specialist. Evaluate {brand_name} across the following dimensions for ChatGPT citation readiness: Wikipedia presence, Wikidata entries, structured data on key pages, co-citation patterns with authoritative sources, and knowledge graph disambiguation. Score each dimension and provide an improvement roadmap...
geochatgptentity
Technical v1.0

Cloudflare Worker Redirect Spec

Produces a Cloudflare Worker script to handle complex redirect logic at the edge without origin server load.

You are an Edge SEO engineer. Write a Cloudflare Worker script for {site_url} that implements the following redirect rules: {redirect_rules_list}. The script must handle 301 permanent redirects, preserve query strings where specified, log redirect events, and avoid redirect loops. Include comments explaining each rule block...
technicaledge-seocloudflare
Ranking v1.0

Competitor SERP Gap Rank Finder

Finds keywords where multiple competitors rank but the target site is absent, sized by traffic opportunity.

Act as a competitive SEO analyst. Using the keyword ranking data for {competitor_domains} and {site_url}, identify all keywords where at least two competitors rank in the top 20 but {site_url} does not appear at all. Size each gap by estimated monthly search volume and group by topic cluster...
rankingcompetitor-gapkeywords
Content v1.0

Content Brief SERP Intent Sync

Generates a content brief precisely aligned to the dominant SERP intent and format signals for a target keyword.

Act as a content strategist. Analyze the top 10 SERP results for '{target_keyword}' and extract the dominant intent type, content format, average word count, heading structure patterns, and common subtopics covered. Use these signals to produce a full content brief for {site_url} that is precisely aligned with SERP expectations...
contentcontent-briefserp-intent
Content v1.0

Content Outline Entity Enrichment

Enriches a content outline with entity relationships and semantic signals to improve topical authority coverage.

You are a semantic SEO content architect. Take the following content outline for '{topic}' and enrich each section with: (1) key entities and their relationships to include, (2) supporting facts or statistics to embed, (3) E-E-A-T signals to demonstrate, and (4) internal linking targets from {site_url}...
contententityoutline
Audit v1.0

Core Web Vitals CrUX Template Audit

Diagnoses CrUX field data CWV failures segmented by page template to surface highest-impact fix areas.

You are a Core Web Vitals performance analyst. Using the CrUX field data export provided for {site_url}, segment LCP, INP, and CLS failures by page template. Rank templates by the volume of poor URLs and estimated traffic impact, then suggest root causes and fixes for each failing template...
auditcwvperformance
Audit v1.0

Crawl Budget Priority Review

Reviews crawl budget allocation and identifies low-value URLs consuming disproportionate Googlebot visits.

Act as a crawl budget optimization expert. Given the log file summary and URL inventory for {site_url}, identify low-value URLs (faceted parameters, session IDs, thin pages) consuming crawl budget, and produce a directive plan using robots.txt and canonical tags to reclaim budget for high-value pages...
auditcrawl-budgetlog-file
GEO v1.0

Entity Prominence Gap Brief

Diagnoses which entity attributes for a brand are underrepresented in LLM training signals and knowledge graphs.

You are a knowledge graph and GEO specialist. Analyze {brand_name} by querying its entity footprint across Wikidata, schema.org markup, Google Knowledge Panel attributes, and third-party mention profiles. Identify the five most underdeveloped entity attributes affecting LLM citation accuracy and provide enrichment recommendations...
geoentityknowledge-graph
Content v1.0

FAQ Entity Intent Generator

Generates FAQ content blocks aligned to entity relationships and PAA question intent for a target topic.

Act as an SEO content writer. For the topic '{topic}', generate 10 FAQ entries that: (1) directly address People Also Ask questions from the SERP, (2) incorporate key entity relationships relevant to {brand_or_site}, (3) are structured for FAQPage schema markup, and (4) use natural language that matches the query intent of each question...
contentfaqentity
Ranking v1.0

Featured Snippet Format Gap Audit

Audits target keywords for featured snippet format types and identifies content reformatting opportunities.

You are a featured snippet optimization specialist. For the following keywords where {site_url} ranks in positions 2–10: {keyword_list}, identify the current featured snippet format (paragraph, list, table, video). For each, determine whether {site_url}'s content is formatted to compete for the snippet and provide a specific reformatting recommendation...
rankingfeatured-snippetserp
GEO v1.0

Generative SERP Source Fit Scorer

Scores existing content pages on their fit for generative SERP feature inclusion using key citation signals.

You are a generative SERP analyst. Review the following URLs from {site_url} and score each on generative SERP source fit using these criteria: passage extractability, factual specificity, E-E-A-T signals, recency, and structured markup presence. Return a scored table and a prioritized optimization backlog...
geogenerative-serpscoring
GEO v1.0

GEO Content Brief Depth Signals

Builds a GEO-optimized content brief that embeds the depth signals needed to attract LLM citations.

Act as a GEO content strategist. Create a content brief for the topic '{topic}' targeting LLM citation by ChatGPT, Perplexity, and Google AI Overviews. Include required passage types, minimum factual depth requirements, entity relationships to establish, and recommended source citation patterns...
geocontent-briefllm
Technical v1.0

JSON-LD Breadcrumb Path Builder

Generates valid JSON-LD BreadcrumbList markup for any page path to enable breadcrumb rich results.

Act as a structured data engineer. Given the following site hierarchy and page paths for {site_url}: {page_paths}, generate valid JSON-LD BreadcrumbList markup for each path. Ensure item IDs use absolute URLs, names match the visible breadcrumb labels, and the markup validates against Google's rich result requirements...
technicaljson-ldbreadcrumbs
Ranking v1.0

Keyword Cannibalization Cluster Fix

Identifies keyword cannibalization clusters and produces a consolidation or differentiation fix plan.

You are a keyword cannibalization specialist. Using the ranking data provided for {site_url}, identify all keyword clusters where two or more pages are competing within the top 20. For each cluster, recommend whether to consolidate (merge + redirect), differentiate (modify intent), or canonicalize, and provide the specific implementation steps...
rankingcannibalizationkeywords
Ranking v1.0

Knowledge Panel Gap Optimizer

Identifies missing or incorrect knowledge panel attributes for a brand and produces a signal enrichment plan.

You are a knowledge panel SEO specialist. Audit the current Google Knowledge Panel for {brand_name} and compare it against the complete set of desired attributes: {attribute_list}. For each missing or incorrect attribute, identify the likely data source Google is using and recommend the specific action to correct or add it...
rankingknowledge-panelentity
Technical v1.0

LCP Resource Load Fix Spec

Diagnoses the LCP resource load chain for a page and produces a technical fix spec to hit the 2.5s threshold.

Act as a Core Web Vitals performance engineer. Using the WebPageTest and CrUX data provided for {url}, trace the full LCP resource load chain: DNS, TCP, TTFB, resource discovery, and render delay. Identify each bottleneck contributing to the LCP score exceeding 2.5s and produce a prioritized technical fix specification with estimated time savings per fix...
technicallcpperformance
GEO v1.0

LLM Source Authority Signal Brief

Models which authority signals most influence LLM source selection for a given topic and domain.

Act as an LLM source authority analyst. For the topic '{topic}', analyze the content and authority signals of the top five sources currently cited by major LLMs. Model the common authority patterns (domain age, citation backlink profile, content freshness, author credentials) and produce a gap report for {brand_url}...
geoauthorityllm
Ranking v1.0

Local Pack Prominence Gap Audit

Audits local pack ranking signals for a business to identify prominence gaps versus top local competitors.

Act as a local SEO specialist. Compare the Google Business Profile and local ranking signals for {business_name} in {location} against the top three local pack competitors. Identify gaps in review velocity, category configuration, citation consistency, and proximity signals, and provide a 90-day prominence improvement plan...
rankinglocal-packlocal-seo
Audit v1.0

Orphan Page Equity Gap Audit

Detects orphaned pages with no internal links and maps the best linking opportunities to restore equity flow.

You are a technical SEO specialist. Given the following crawl data and sitemap for {site_url}, identify all orphaned pages (zero inbound internal links), estimate their traffic potential, and recommend the top internal linking opportunities to restore crawl equity...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Topical Cluster Builder

Mines People Also Ask questions for a seed topic to build a structured topical cluster content plan.

Act as a topical SEO strategist. Using the following People Also Ask data collected for the seed topic '{seed_topic}', group questions into semantic clusters, identify which clusters {site_url} has no content for, and produce a prioritized content plan with recommended formats for each cluster...
rankingpaatopical-cluster
Technical v1.0

Prerender Eligibility SEO Config

Evaluates page eligibility for prerendering and produces a configuration spec for SEO-safe prerender deployment.

Act as a rendering SEO engineer. Evaluate the following page types on {site_url} for prerendering eligibility: {page_types}. For each type, assess: JavaScript dependency level, personalization requirements, real-time data needs, and crawl frequency. Produce a prerendering configuration spec using {prerender_solution} that safely serves pre-rendered HTML to bots while maintaining dynamic rendering for users...
technicalprerenderingrendering
Content v1.0

Programmatic Content Schema Template

Designs a scalable programmatic content template that embeds structured data for rich result eligibility.

You are a programmatic SEO architect. Design a content template for {page_type} pages at scale for {site_url}. The template must include: dynamic content slots with uniqueness requirements, JSON-LD schema markup appropriate to the page type, internal linking logic, and E-E-A-T signal embedding rules. Provide the template structure and variable mapping guide...
contentprogrammaticschema
Technical v1.0

Robots.txt Crawl Waste Spec

Generates a robots.txt directive set to block low-value URL patterns and reclaim crawl budget for priority pages.

You are a technical SEO engineer. Based on the following URL pattern inventory for {site_url}, generate a robots.txt configuration that disallows crawling of: duplicate parameter URLs, internal search results, user account pages, and staging path patterns. Include Googlebot-specific and wildcard rules, and document the rationale for each directive block...
technicalrobots-txtcrawl-budget
Ranking v1.0

SERP Intent Mismatch Gap Finder

Identifies keywords where the current ranking page mismatches dominant SERP intent and recommends fixes.

Act as a SERP intent analyst. For each keyword in the following list: {keyword_list}, classify the dominant SERP intent (informational, navigational, commercial, transactional) by analyzing the top 10 results. Flag any keywords where {site_url}'s ranking page intent does not match, and recommend the correct content type to align with SERP intent...
rankingintentserp
Ranking v1.0

SERP Volatility Root Cause Audit

Diagnoses the root causes of ranking volatility for a specific URL or keyword set over a defined time window.

You are a SERP volatility analyst. Given the ranking history data for {url_or_keyword_set} over the past {time_period}, identify patterns in ranking fluctuations. Correlate volatility spikes with known algorithm updates, competitor content changes, and on-page modifications. Produce a root cause report with stabilization recommendations...
rankingvolatilityserp
Technical v1.0

Sitemap Index Split Architect

Designs a sitemap index architecture that splits large URL sets by template type for optimized crawl signaling.

You are an XML sitemap architect. Given the URL inventory for {site_url} totaling {url_count} URLs, design a sitemap index structure that splits URLs into sub-sitemaps by page type (e.g., product, category, blog, landing page). Define crawl priority and changefreq values per template type, set update scheduling, and provide the sitemap index XML structure...
technicalsitemapcrawl
Technical v1.0

SSR Hydration Config Spec

Produces a server-side rendering hydration configuration spec to ensure full SEO content visibility at crawl time.

Act as a technical SEO and front-end architect. Review the current rendering approach for {site_url} using the following JavaScript framework: {framework}. Identify any hydration mismatches, deferred content that is invisible to crawlers, or client-side data fetching that bypasses SSR. Produce a hydration configuration spec that ensures all SEO-critical content is present in the initial HTML response...
technicalssrrendering
Audit v1.0

Technical Site Crawl Signal Audit

Identifies crawl signal issues across a site by reviewing crawlability, indexability, and response codes.

Act as a senior technical SEO auditor. Given the following crawl export data for {site_url}, identify all crawl signal issues including 4xx/5xx errors, noindex misuse, and blocked resources, then prioritize fixes by SEO impact...
auditcrawltechnical
Content v1.0

Topic Cluster Gap Content Finder

Analyzes an existing topic cluster to find subtopic gaps weakening topical authority and recommends new content.

Act as a topical authority content strategist. Given the existing content inventory for the '{cluster_topic}' cluster on {site_url}, identify all significant subtopics that competitors cover but {site_url} does not. Prioritize gaps by search volume and topical authority impact, and recommend content types for each...
contenttopic-clustergap-analysis
GEO v1.0

AI Mode Passage Retrieval Plan

Designs page-level content structures optimized for passage retrieval in Google's AI Mode.

You are a Google AI Mode optimization specialist. Given this existing page content for {target_url}: {page_content} and the target queries: {target_queries}, restructure the content into discrete, self-contained passages that directly answer each query, add appropriate entity anchoring and factual density per passage, and output the revised content structure with annotations explaining each AI Mode retrieval optimization...
geoai-modepassage-retrieval
GEO v1.0

AI Overview Query Fit Scorer

Scores a list of target queries by their likelihood of triggering an AI Overview citation.

You are a Generative Engine Optimization specialist. Given this list of target queries: {query_list}, score each query from 1–10 on its likelihood to trigger a Google AI Overview, based on factors including query intent type (informational, navigational, transactional), question format, topic complexity, and multi-source synthesis need. Output a table with: Query, AI Overview Likelihood Score, Key Trigger Factors, Recommended Content Format to capture citation.
geoai-overviewquery-intent
Content v1.0

Anchor Text Profile Diversity Planner

Audits an internal anchor text profile and generates a diversification plan for target pages.

You are an internal link and anchor text strategist. Given the current internal anchor text distribution for {target_page}: {anchor_text_data}, analyze the ratio of exact-match, phrase-match, branded, generic, and naked URL anchors, compare against a healthy distribution benchmark, identify over-optimized or under-represented anchor types, and produce a rewrite plan for the top 20 internal links pointing to {target_page} with recommended anchor text variants...
contentanchor-textinternal-links
Technical v1.0

CDN Cache Control SEO Header Spec

Specifies Cache-Control and CDN header rules optimized for SEO crawlability and performance.

You are an edge SEO and CDN configuration specialist. Given this site's page type inventory: {page_type_inventory} and current CDN provider: {cdn_provider}, design Cache-Control header rules for each page type (HTML, CSS, JS, images) that balance: Googlebot cache freshness requirements, user browser caching efficiency, CDN hit rate maximization, and correct Vary header usage for mobile/desktop content variants. Output CDN rule configurations in {cdn_provider}-compatible syntax...
technicalcdncache-control
GEO v1.0

ChatGPT Entity Citation Gap Plan

Forecasts what entity signals ChatGPT needs to consistently cite your brand in relevant answers.

You are a Generative Engine Optimization strategist. Given the brand entity profile for {brand_name}: {entity_profile}, and the following topic clusters where citations are desired: {topic_clusters}, identify the specific entity associations, co-occurrence signals, and content depth gaps that prevent ChatGPT from citing {brand_name}, then produce a 90-day entity signal building plan...
geochatgptentity
GEO v1.0

Citation Pre-Publish Signal Checker

Evaluates a content draft for LLM citation readiness before it is published.

You are a GEO content reviewer. Before publishing, evaluate this content draft: {content_draft} against the following citation readiness criteria: (1) factual claim density per 200 words, (2) named entity co-occurrence with {target_entities}, (3) question-answer passage completeness, (4) author E-E-A-T signal presence, (5) structured data eligibility. Score each criterion 1–5 and provide specific edits to reach a minimum score of 4 on each...
geocitationcontent
Ranking v1.0

Cluster Opportunity Revenue Sizer

Sizes keyword cluster opportunities by estimated organic revenue potential for prioritization.

You are an SEO opportunity sizing analyst. Given these keyword clusters: {keyword_clusters} with associated search volumes and your site's average conversion rate {cvr} and average order value {aov}, calculate estimated organic revenue opportunity per cluster assuming realistic CTR curves at positions 1, 3, 5, and 10. Output a prioritization matrix ranked by revenue opportunity with current ranking position and gap-to-target...
rankingkeyword-clustersrevenue
Ranking v1.0

Competitor Content Gap Rank Brief

Identifies queries where multiple competitors rank but your domain has no ranking content.

You are a competitive SEO analyst. Given the organic keyword rankings for competitors {competitor_list} and {your_domain} in this dataset: {ranking_data}, identify all queries where 2 or more competitors rank in positions 1–20 but {your_domain} has no ranking URL, group them by topic cluster, estimate combined monthly search volume per cluster, and output a content creation brief prioritized by cluster size and competitor ranking strength...
rankingcompetitor-gapcontent
Content v1.0

Content Outline Competitor Depth Map

Creates a content outline that exceeds competitor depth on every major subtopic for a keyword.

You are a content outline specialist. Given the top 5 ranking articles for {target_keyword}: {competitor_content_summaries}, map every subtopic covered by each competitor, identify subtopics covered by all 5 (table stakes), subtopics covered by 2–4 (differentiators), and subtopics covered by 0–1 (blue ocean). Build a comprehensive H2/H3 outline for {your_brand} that covers all table-stakes sections with greater depth and captures at least 3 blue-ocean sections...
contentoutlinecompetitor-gap
Content v1.0

Content Refresh Traffic Decay Brief

Produces a structured refresh brief for a decaying article to recover lost organic traffic.

You are a content refresh strategist. Given this decaying article: {article_url} with traffic history: {traffic_data} and current SERP competitors: {current_serp_competitors}, diagnose why traffic dropped (intent shift, freshness, competitor improvements, SERP feature displacement), then produce a refresh brief specifying: sections to update, new data/statistics to add, structural changes, internal links to add, and schema improvements needed to recover position {target_position}...
contentcontent-refreshtraffic-decay
Audit v1.0

Core Web Vitals Template Triage

Triages CWV failures by page template to identify which template fixes will have the most impact.

You are a Core Web Vitals performance auditor. Given this CrUX field data segmented by URL pattern: {crux_template_data}, group LCP, INP, and CLS failures by page template (e.g., homepage, PDP, category, blog), calculate the percentage of poor URLs per template, and rank templates by fix-impact score (affected URLs × avg metric delta from threshold)...
auditcore-web-vitalsperformance
Content v1.0

FAQ Intent Expansion Generator

Generates a comprehensive FAQ section from PAA data and search intent signals for a topic.

You are an FAQ content specialist. Given the topic {topic}, its PAA questions: {paa_questions}, and related forum/Reddit questions: {community_questions}, generate a structured FAQ section with 10–15 questions covering all intent variants (how-to, definition, comparison, troubleshooting, pricing). Each answer must be 40–60 words, directly answer the question, and be formatted for FAQPage schema markup. Include the complete JSON-LD FAQPage schema block at the end...
contentfaqschema
Ranking v1.0

Featured Snippet Content Gap Fixer

Identifies exactly what content is missing from a page to win a target featured snippet.

You are a featured snippet optimization specialist. Given the current ranking page content for {target_url}: {page_content} and the current featured snippet holder's content: {competitor_snippet_content} for the query {target_query}, perform a gap analysis identifying the specific sentence structures, answer formats (paragraph, list, table), and factual elements your page must add or restructure to displace the current snippet holder...
rankingfeatured-snippetcontent-gap
GEO v1.0

Generative SERP Topical Authority Map

Maps topical authority gaps preventing your domain from appearing in generative SERP features.

You are a GEO topical authority strategist. Given the topical map for {domain}: {topical_map} and the generative SERP features appearing for queries in {niche}, identify which sub-topics your domain lacks sufficient depth or breadth to be considered an authoritative source by AI systems, and output a content investment plan ranked by estimated generative visibility gain...
geotopical-authoritygenerative-serp
GEO v1.0

GEO Content Brief Depth Planner

Builds a GEO-optimized content brief engineered for AI source selection on a specific topic.

You are a GEO content strategist. Create a content brief for the topic {topic} specifically designed to maximize citation probability in AI Overviews and LLM answers. The brief must specify: required factual claims with citation opportunities, optimal content structure for AI passage retrieval, entity associations to include, E-E-A-T signals to embed, and semantic completeness requirements for {target_audience}...
geocontent-briefai-overview
Technical v1.0

Hreflang XML Sitemap Locale Spec

Generates a complete hreflang sitemap configuration spec for a multi-locale site.

You are an international SEO technical specialist. Given this list of locale variants and their URL patterns for {domain}: {locale_url_map}, generate the complete hreflang XML sitemap configuration including: sitemap index structure for locale splits, correct xhtml:link hreflang entries for every locale pair, x-default assignment logic, and reciprocal return tag verification rules. Output the sitemap XML template and a QA checklist for implementation validation...
technicalhreflangsitemap
Ranking v1.0

Image SERP Optimization Spec

Produces an optimization spec for images targeting visibility in Google Image Search results.

You are an image SEO specialist. Given this list of target images on {domain}: {image_inventory} and the target informational queries: {target_queries}, audit each image for: filename descriptiveness, alt text keyword alignment, surrounding text context, structured data eligibility (ImageObject), page authority, and file format/size. Output a prioritized optimization spec for each image to maximize Google Image SERP visibility...
rankingimage-serpstructured-data
Audit v1.0

Indexing Exclusion Reason Report

Diagnoses why specific URLs are excluded from Google's index using GSC coverage data.

You are an SEO indexing specialist. Given this Google Search Console URL Coverage export: {gsc_coverage_export}, group all non-indexed URLs by exclusion reason (e.g., Crawled but not indexed, Discovered but not crawled, Blocked by robots.txt, noindex), identify the top 3 exclusion reasons by volume, and for each provide a root-cause hypothesis and remediation checklist.
auditindexinggsc
Technical v1.0

INP Interaction Trace Root Cause

Diagnoses the root cause of poor INP scores from interaction traces and long task data.

You are a Core Web Vitals performance engineer. Given this INP interaction trace data from Chrome DevTools / WebPageTest: {inp_trace_data} for page {page_url}, identify the specific interaction events (click, keypress, tap) causing delays above 200ms, trace each to its processing phase (input delay, processing time, presentation delay), identify the JavaScript functions or render-blocking tasks responsible, and output a prioritized fix list with code-level recommendations...
technicalinpcore-web-vitals
GEO v1.0

LLM Source Recency Gap Analyzer

Identifies content freshness gaps that reduce your domain's LLM citation recency scores.

You are a GEO recency specialist. Given this content inventory for {domain}: {content_inventory} with publish and update dates, identify all pages on high-priority GEO topics that have not been updated within {recency_threshold} days, estimate their recency penalty in LLM source selection, and produce a refresh prioritization list ranked by citation opportunity size × content staleness score...
georecencycontent-refresh
Ranking v1.0

Local Pack Competitor Signal Gap

Compares your GBP and local signals against top local pack competitors to find ranking gaps.

You are a local SEO analyst. Given the Google Business Profile data for {your_business}: {your_gbp_data} and the top 3 local pack competitors for {target_keyword} in {location}: {competitor_gbp_data}, compare all ranking signals (review count, review velocity, review sentiment, category accuracy, citation consistency, photo count, post frequency, Q&A volume), identify your gaps, and output a 30-day local signal improvement plan...
rankinglocal-packgbp
Ranking v1.0

News SERP Freshness Signal Audit

Audits a publisher's content and technical setup for Google News and Top Stories eligibility.

You are a News SEO specialist. Given the site configuration and recent article data for {domain}: {site_config} and {article_data}, evaluate eligibility for Google News and Top Stories by checking: publication date structured data accuracy, AMP or Web Stories implementation, article schema completeness, crawl frequency vs. publication frequency, byline and author markup, and E-E-A-T signals. Output a gap report with priority fixes...
rankingnews-serpfreshness
Audit v1.0

Orphan Page Equity Loss Audit

Finds orphaned pages with ranking potential that are losing link equity due to no internal links.

You are a technical SEO specialist. Given this list of indexed URLs from GSC: {gsc_url_list} and this crawled internal link graph: {internal_link_graph}, identify all URLs that appear in GSC but receive zero internal links, then cross-reference with organic impression data to flag orphans with ranking potential that need immediate internal linking...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Intent Cluster Expansion Map

Mines PAA questions to build intent-clustered content expansion opportunities.

You are an SEO SERP analyst. Given this seed keyword {seed_keyword} and its associated People Also Ask questions: {paa_questions}, cluster all PAA questions by underlying search intent (informational, navigational, commercial, transactional), identify which clusters your site has no content for, size each cluster by combined search volume, and recommend specific content formats (FAQ section, standalone article, table) for each gap...
rankingpaaintent
Technical v1.0

Prerender SEO Eligibility Config

Assesses whether a site's JS-rendered pages qualify for prerendering and outputs the configuration spec.

You are a JavaScript SEO and prerendering specialist. Given this site's rendering architecture: {rendering_architecture} and this list of critical page templates: {page_templates}, evaluate each template's eligibility for prerendering by checking: dynamic content requirements, authentication dependencies, real-time data needs, and Googlebot crawl frequency. For eligible templates, output the prerendering configuration spec for {prerender_service} including cache TTL, bot detection rules, and exclusion patterns...
technicalprerenderingjavascript-seo
Content v1.0

Programmatic SEO Content Schema Planner

Designs the content schema and variable fields for a programmatic SEO template at scale.

You are a programmatic SEO architect. Given the page type {page_type} targeting the keyword pattern {keyword_pattern} with data source {data_source}, design a complete programmatic content template including: fixed content blocks (intro, CTA, FAQs), dynamic variable fields with data source mappings, minimum unique content threshold per page, internal linking logic, schema markup type and dynamic fields, and quality gate rules to prevent thin content...
contentprogrammatic-seotemplate
Technical v1.0

Schema Markup JSON-LD Generator

Generates production-ready JSON-LD schema markup for any Schema.org type from input data.

You are a structured data engineer. Given the following entity data: {entity_data} and the target Schema.org type: {schema_type}, generate a complete, valid JSON-LD script block suitable for production deployment. Include all required properties, recommended properties where data is available, and nest related types (e.g., Organization within Article's publisher). Validate the output against Google's Rich Results requirements for {schema_type} and flag any missing required fields...
technicalschemajson-ld
Technical v1.0

Robots.txt Crawl Rule Optimizer

Audits and rewrites a robots.txt file to protect crawl budget without blocking indexable content.

You are a technical SEO engineer specializing in crawl budget optimization. Given this current robots.txt file: {robots_txt_content} and this list of URL patterns and their indexing value: {url_pattern_values}, identify all rules that may be blocking valuable content, rules that are failing to block low-value URL patterns (faceted nav, session IDs, internal search), and conflicting directives. Output a rewritten robots.txt with inline comments explaining each rule change...
technicalrobots-txtcrawl-budget
Technical v1.0

Security Headers SEO Risk Auditor

Audits HTTP security headers for configurations that could negatively impact SEO or crawlability.

You are a technical SEO security specialist. Given this HTTP response header set for {domain}: {header_data}, audit the following headers for SEO impact: Content-Security-Policy (blocking Googlebot resource loading), X-Frame-Options, Strict-Transport-Security (HSTS preload status), X-Robots-Tag (unintended noindex directives), Referrer-Policy (impact on analytics), and CORS headers (blocking structured data validation tools). Flag any misconfigurations and output corrected header values...
technicalsecurity-headerscrawl
Ranking v1.0

SERP Volatility Root Cause Map

Diagnoses the root causes of ranking volatility for a set of target keywords over a time window.

You are an SEO volatility analyst. Given this ranking history data for {domain} across these keywords: {ranking_history} over the period {date_range}, identify all ranking drop events of 5+ positions, correlate each event with known algorithm updates, competitor content changes, or on-site technical events in {event_log}, and produce a root-cause table with: Keyword, Drop Date, Position Change, Most Likely Cause, Evidence, Recommended Response...
rankingvolatilityalgorithm
Ranking v1.0

Shopping SERP Feed Gap Auditor

Identifies product feed attribute gaps that limit Shopping SERP impression share and visibility.

You are a Shopping SEO analyst. Given this Merchant Center product feed sample: {feed_data} and the top-performing competitor listings for {product_category}: {competitor_listings}, compare all required and recommended feed attributes (title, description, image quality, GTIN, brand, price, availability, product_type, custom_labels), identify gaps and suboptimal values, and output a feed optimization brief ranked by estimated impression share impact...
rankingshopping-serpfeed
Audit v1.0

Technical Site Crawl Issues Map

Generates a prioritized map of crawl issues found across a site's URL structure.

You are a technical SEO auditor. Given the following list of URLs and their HTTP status codes: {url_status_list}, identify all crawl issues (4xx, 5xx, redirect chains, soft 404s), group them by issue type, and output a prioritized fix table with columns: URL, Issue Type, Priority (High/Med/Low), Recommended Action.
auditcrawltechnical
Content v1.0

Title Meta SERP CTR Optimizer

Rewrites title tags and meta descriptions to maximize CTR using SERP psychology principles.

You are a CTR optimization copywriter. Given these underperforming page titles and meta descriptions: {title_meta_list} with their current CTR data from GSC: {ctr_data} and target keywords: {keywords}, rewrite each title (50–60 characters) and meta description (150–160 characters) applying: power words, query keyword inclusion, unique value proposition, number/date inclusion where relevant, and emotional triggers appropriate for {audience}. Output before/after pairs...
contentctrmeta
Content v1.0

Topic Cluster Content Gap Filler

Identifies content gaps within an existing topic cluster and prescribes new supporting articles.

You are a topic cluster content strategist. Given the existing content cluster for pillar topic {pillar_topic}: {existing_cluster_urls} and the full keyword universe for this topic: {keyword_universe}, identify sub-topics within {pillar_topic} that lack a dedicated supporting article, group them by thematic similarity, estimate search volume per group, and output a content creation roadmap with working titles, target keywords, recommended formats, and internal link placement for each new article...
contenttopic-clustercontent-gap
Ranking v1.0

Video SERP Schema Eligibility Plan

Assesses video content pages for Video SERP rich result eligibility and outputs a fix plan.

You are a video SEO specialist. Given these video page URLs and their current markup: {video_page_data}, evaluate each page against Google's VideoObject schema requirements (name, description, thumbnailUrl, uploadDate, contentUrl/embedUrl, duration), identify missing or malformed properties, check for video sitemap inclusion, and output a structured remediation plan to unlock Video rich results in SERPs...
rankingvideo-serpschema
Technical v1.0

XML Sitemap Priority Logic Builder

Designs XML sitemap structure, index split logic, and priority/changefreq values for a large site.

You are a technical SEO sitemap architect. Given this site architecture overview for {domain}: {site_architecture} with {total_url_count} indexable URLs across {page_type_list}, design a complete sitemap strategy including: sitemap index file structure, individual sitemap splits by page type, maximum URL counts per sitemap file, priority value logic per template, changefreq recommendations per content type, and lastmod update automation approach...
technicalsitemapcrawl
GEO v1.0

AI Overview Content Depth Scorer

Scores a piece of content on depth and structure factors that increase AI Overview inclusion likelihood.

Evaluate the following content from {page_url} against the known signals that influence Google AI Overview inclusion: factual density, passage-level clarity, structured formatting, entity specificity, and source authority indicators. Provide a score out of 100 and actionable fixes...
geoai-overviewcontent
Content v1.0

Anchor Text Diversity Strategy

Builds an anchor text distribution strategy for a target page balancing exact match and natural variation.

Create an anchor text strategy for the page {target_page_url} targeting '{primary_keyword}'. Specify the recommended distribution of exact match, partial match, branded, and generic anchors across internal links. Include 10 example anchor text variants and guidance for each context type...
contentanchor-textinternal-links
GEO v1.0

Brand Mention Coverage Mapper

Maps where and how a brand is mentioned across LLM training-likely sources for a given topic set.

For the brand {brand_name} and topic cluster {topic_cluster}, map existing third-party mentions across: news articles, Wikipedia, Reddit, industry publications, and review platforms. Identify mention gaps by topic and source type, and recommend a coverage plan...
geobrand-mentioncoverage
GEO v1.0

Claude Citation Readiness Brief

Evaluates content structure and authority signals for eligibility as a Claude source citation.

Evaluate whether the content at {page_url} meets the structural and authority criteria that increase Claude citation likelihood. Assess: passage clarity, factual verifiability, author credentials, source diversity, and topical specificity. Provide a citation readiness score and gap list...
geoclaudecitation
Ranking v1.0

Cluster Opportunity Size Ranker

Ranks topic cluster opportunities by traffic potential, competition, and current content coverage.

Evaluate the following topic clusters for {site_url}: {cluster_list}. Score each by: total cluster search volume, average keyword difficulty, current content coverage percentage, and topical authority signals. Output a ranked opportunity matrix with recommended build-vs-improve decisions...
rankingclusteropportunity
Ranking v1.0

Competitor SERP Share Gap Finder

Analyzes SERP share data to find keyword gaps where competitors rank but the target site does not.

Given the following SERP position data for {site_url} and competitors {competitor_list} across {keyword_count} keywords, identify all keywords where at least two competitors rank in positions 1-10 but {site_url} does not appear in the top 20. Prioritize by estimated traffic opportunity...
rankingcompetitorgap-analysis
Content v1.0

Content Brief Intent Match Builder

Generates a full content brief aligned to SERP intent signals for a target keyword.

Create a comprehensive content brief for the target keyword '{target_keyword}' for {site_url}. Analyze SERP intent, identify the dominant content format, required headings, semantic entity coverage, word count target, E-E-A-T signals, and internal linking anchors. Structure as an actionable writer brief...
contentbriefintent
Content v1.0

Content Gap Demand Prioritizer

Prioritizes content gap topics by search demand, business relevance, and competitive difficulty.

Given the following list of content gaps identified for {site_url} vs competitors {competitor_list}: {gap_topic_list}, score each gap on: monthly search volume, keyword difficulty, business relevance (scale 1-5), and competitor content quality. Output a prioritized content calendar...
contentgap-analysisprioritization
Content v1.0

Content Outline Topic Cluster Fit

Builds a content outline engineered to serve as the hub page for a defined topic cluster.

Create a detailed content outline for a hub page targeting '{hub_topic}' that anchors a topic cluster on {site_url}. Include H1, H2, H3 structure, spoke page link targets, semantic entity requirements, FAQ schema blocks, and word count guidelines for each section...
contentoutlinecluster
Content v1.0

Content Refresh Traffic Loss Plan

Creates a targeted refresh plan for pages showing measurable organic traffic decline.

Analyze the following pages from {site_url} that have experienced >20% organic traffic decline over 6 months: {declining_pages_list}. For each page, diagnose the likely cause of decay (freshness, intent shift, new competition, thin content) and prescribe a specific refresh action plan...
contentrefreshdecay
Content v1.0

E-E-A-T Page Level Scorer

Scores a specific page's E-E-A-T signals and provides a concrete improvement checklist.

Evaluate the following page content from {page_url} against Google's E-E-A-T quality criteria: Experience, Expertise, Authoritativeness, and Trustworthiness. Score each dimension out of 25, identify the weakest signals, and provide a specific improvement checklist for each dimension...
contente-e-a-tquality
Technical v1.0

Edge SEO Redirect Rule Builder

Writes Cloudflare Worker or edge middleware redirect rules for complex SEO redirect requirements.

Write a Cloudflare Worker script to handle the following redirect requirements for {site_url}: {redirect_rules_list}. Implement 301 redirects for all rules, preserve query parameters where specified, handle trailing slash normalization, and add response headers for SEO verification...
technicaledge-seoredirects
Content v1.0

FAQ Schema Intent Block Builder

Generates FAQ content blocks with embedded schema markup aligned to PAA and voice search intent.

Generate a FAQ section with 8 questions and answers for the topic '{topic}' targeting voice search and PAA visibility. Each answer must be 40-60 words, directly answer the question, and include the necessary FAQPage JSON-LD schema markup for the full block...
contentfaqschema
Audit v1.0

Hreflang Return Tag Validator

Checks hreflang tag pairs for missing return tags and locale-region mismatches across pages.

Review the following hreflang tag data for {site_url}: {hreflang_tag_list}. Identify any pages missing reciprocal return tags, incorrect locale-region codes, or x-default misconfigurations. Output a structured error report...
audithreflanginternational
Technical v1.0

INP Interaction Trace Fixer

Diagnoses high INP scores using interaction trace data and produces a JavaScript optimization plan.

Analyze the following INP interaction trace data for {page_url}: {trace_data}. Identify the longest interaction events, locate the main thread blocking tasks, pinpoint the JavaScript functions responsible for input delay, and provide a prioritized optimization plan with code-level recommendations...
technicalinpcore-web-vitals
Audit v1.0

Internal Link Depth Audit

Maps click depth of key pages from the homepage and surfaces pages buried beyond three clicks.

Using the following internal link graph data for {site_url}, calculate the click depth of each URL from the homepage. Flag all priority pages (defined by {priority_url_list}) that are more than 3 clicks deep and suggest structural fixes...
auditinternal-linkscrawl
Ranking v1.0

Keyword Cannibalization Split Planner

Resolves keyword cannibalization by assigning clear intent ownership to competing pages.

Given these cannibalized pages for '{target_keyword}': {page_list}, analyze their content, intent signals, and ranking history. Determine which page should be the canonical owner, how to differentiate the others by sub-intent, and produce a consolidation or differentiation action plan...
rankingcannibalizationintent
GEO v1.0

LLM Source Freshness Signal Audit

Diagnoses whether content freshness signals on key pages are strong enough for LLM recency preference.

Analyze the following pages from {domain} for freshness signals relevant to LLM source selection: last-modified dates, publication date schema markup, content update frequency, changelog presence, and recency of cited statistics. Output a freshness signal score and fix plan...
geofreshnessllm
GEO v1.0

Multi-LLM Response Gap Tracker

Compares brand mention presence across ChatGPT, Claude, and Perplexity responses for target queries.

Given the following responses from ChatGPT, Claude, and Perplexity for the query '{target_query}', identify which models mention {brand_name}, in what context, with what sentiment, and where the brand is absent. Produce a gap matrix and citation improvement plan...
geomulti-llmcitation
Ranking v1.0

Local Pack Signal Gap Matrix

Builds a gap matrix comparing local pack ranking signals between a target business and top competitors.

Compare the Google Business Profile signals, review velocity, citation consistency, on-page local SEO, and proximity factors for {business_name} against the top 3 local pack competitors for the query '{local_query}'. Output a signal gap matrix with prioritized actions...
rankinglocal-packgap-analysis
Audit v1.0

Orphan Page Link Gap Finder

Identifies orphaned pages with no internal links and recommends the best linking opportunities.

You are given a list of crawled URLs for {site_url} and a separate list of URLs receiving zero internal links. For each orphan page, identify the top 3 existing pages that should link to it based on topical relevance, and suggest anchor text...
auditinternal-linksorphan
Ranking v1.0

PAA Question Intent Expander

Expands a seed keyword into a mapped PAA question tree with intent labels and content assignments.

Using the seed keyword '{seed_keyword}', generate a People Also Ask expansion tree of at least 20 related questions. Classify each by intent type, group into sub-topic clusters, and recommend which existing or new page on {site_url} should target each question...
rankingpaaintent
Technical v1.0

Prerender SEO Config Spec

Specifies prerendering configuration for a JavaScript-heavy site to ensure full SEO content delivery.

Design a prerendering configuration spec for {site_url} built on {framework}. Define which URL patterns require prerendering, the prerender trigger conditions (bot user agent list), caching strategy for prerendered snapshots, and validation tests to confirm Googlebot receives complete HTML content...
technicalprerenderrendering
Content v1.0

Programmatic Content Template Designer

Designs a scalable programmatic content template with variable slots and quality guardrails.

Design a programmatic content template for {site_url} targeting the '{page_type}' page type at scale. Define all variable data slots, static content scaffolding, minimum quality thresholds per section, internal link injection logic, and schema markup requirements to ensure each generated page meets index-worthy quality...
contentprogrammatictemplate
Technical v1.0

Robots.txt Crawl Waste Eliminator

Audits a robots.txt file and rewrites it to eliminate crawl waste while protecting priority pages.

Review the following robots.txt file for {site_url}: {robots_txt_content}. Identify all directives that are missing, overly permissive, or incorrectly blocking priority content. Rewrite the robots.txt to block low-value URL patterns, allow priority templates, and include correct sitemap references...
technicalrobots-txtcrawl
Content v1.0

Schema-Rich How-To Content Generator

Drafts a how-to article with fully embedded HowTo schema markup ready for publication.

Write a complete how-to article for '{how_to_topic}' targeting the keyword '{target_keyword}'. Structure the content as numbered steps suitable for HowTo schema, include all required schema properties (name, description, image, supply, tool, step), and embed the JSON-LD at the end...
contenthow-toschema
Ranking v1.0

SERP Intent Type Classifier

Classifies a keyword list by SERP intent type and maps the dominant content format for each.

Classify each keyword in the following list by primary SERP intent (informational, navigational, commercial, transactional) and identify the dominant content format Google currently rewards for each: {keyword_list}. Output a table with intent type, format, and content recommendation...
rankingintentserp
Ranking v1.0

SERP Volatility Root Cause Analysis

Diagnoses the likely cause of ranking volatility for a URL based on temporal position data.

Analyze the following 90-day ranking position history for {page_url} targeting '{target_keyword}': {position_history}. Identify volatility patterns, correlate with known algorithm update dates, and diagnose whether instability is caused by content quality, authority, intent mismatch, or technical issues...
rankingvolatilitydiagnosis
Technical v1.0

Server-Side Render SEO Validator

Validates that server-side rendered pages deliver complete SEO-critical content before JavaScript runs.

Compare the raw HTML response (pre-JavaScript) and the fully rendered DOM for {page_url}. Identify all SEO-critical elements missing from the server-side HTML: title tags, meta descriptions, canonical tags, structured data, H1s, and body content. Output a delta report with rendering fix recommendations...
technicalssrrendering
GEO v1.0

Source Authority Signal Audit

Audits the authority signals on a domain that LLMs use to evaluate source trustworthiness.

Audit {domain} for the authority signals that LLMs use when selecting sources to cite: domain age, topical consistency, backlink authority profile, author credential signals, E-E-A-T indicators, and Wikipedia/Wikidata references. Score and rank improvement actions...
geoauthorityllm
Content v1.0

Title Meta CTR Batch Rewriter

Rewrites title tags and meta descriptions for a URL batch to maximize SERP click-through rate.

Rewrite the title tags and meta descriptions for the following pages to maximize CTR: {page_list_with_current_titles}. For each page, use the target keyword '{target_keyword}', incorporate a compelling value proposition, stay within 60 characters for title and 155 for description...
contentctrmeta
Technical v1.0

XML Sitemap Split Index Spec

Designs a sitemap index architecture that splits large sites by content type and priority tier.

Design an XML sitemap index architecture for {site_url} with approximately {page_count} indexable pages. Specify how to split sitemaps by content type ({content_types}), set priority and changefreq values by template, implement lastmod accurately, and structure the sitemap index file...
technicalsitemapcrawl
GEO v1.0

AI Overview Passage Eligibility Brief

Evaluates whether specific content passages meet Google AI Overview citation eligibility signals.

Review the following content excerpt from {page_url}: {content_excerpt}. Assess each passage against known AI Overview eligibility signals: factual density, direct answer format, source authority markers, and entity clarity. Score each passage out of 10 and recommend specific rewrites to maximize inclusion likelihood for the query {target_query}...
geoai-overviewpassage
Content v1.0

Anchor Text Diversity Gap Planner

Analyzes internal anchor text distribution for a URL and recommends diversified anchor strategies.

Export all internal links pointing to {target_url} from the crawl data {crawl_csv}. Analyze the anchor text distribution: classify each anchor as exact-match, partial-match, branded, generic, or naked URL. Flag over-optimized patterns and anchor text gaps relative to the page's target keywords {target_keywords}. Output a recommended anchor text distribution plan for new internal links...
contentanchor-textinternal-links
Ranking v1.0

Branded Query Impression Share Planner

Analyzes branded query impression share and builds a plan to reclaim SERP ownership for brand terms.

Using GSC data {gsc_csv} and {competitor_ad_data} for {domain}, identify all branded and brand-adjacent queries where {domain} is not achieving 100% impression share. For each gap query, identify who is taking impressions (competitors, affiliates, news), classify the threat type, and recommend SEO and content actions to reclaim SERP dominance for each...
rankingbrandedserp
GEO v1.0

ChatGPT Source Readiness Scorer

Scores a page's structural and content signals for likelihood of ChatGPT citation in Browse mode.

Evaluate the following page {page_url} with content: {page_content}. Score it across six ChatGPT citation readiness dimensions: factual specificity, structured formatting, source transparency, entity recognition, freshness signals, and topical depth. Provide a total score out of 60 with dimension-level recommendations for improvement...
geochatgptcitations
Ranking v1.0

Competitor Content Rank Gap Finder

Finds keywords where competitors rank in top 10 but the target domain has no ranking page.

Using the keyword ranking exports {competitor_rankings_csv} for competitors {competitor_list} and {domain_rankings_csv} for {domain}, identify all keywords where at least two competitors rank in positions 1-10 and {domain} has no ranking URL in the top 50. Group gaps by topic cluster, estimate traffic opportunity, and recommend the content type and angle most likely to compete...
rankingcompetitor-gapkeywords
Content v1.0

Content Brief SERP Feature Match

Generates a content brief with structure and format requirements mapped to target SERP features.

Create a detailed content brief for the target keyword '{target_keyword}' on {domain}. Analyze the current SERP to identify all active SERP features (featured snippet, PAA, knowledge panel, etc.). For each active feature, specify the exact content element, format, word count, and schema markup needed to compete. Include recommended H-tag structure, entity requirements, and E-E-A-T signals...
contentbriefserp
Content v1.0

Content Outline Authority Signal Brief

Produces a content outline with explicit E-E-A-T authority signals mapped to each section.

Create a detailed content outline for an article targeting the keyword '{target_keyword}'. For each H2 and H3 section, specify: the core information to cover, the E-E-A-T signal to embed (e.g., original data, expert quote, case study, external citation), and the target word count. The outline must outperform the top 3 SERP results: {competitor_urls} on both depth and trust signals...
contentoutlinee-e-a-t
Content v1.0

Content Refresh Traffic Loss Prioritizer

Ranks decaying content pages by traffic loss severity and generates targeted refresh action plans.

Analyze the GSC performance data {gsc_csv} for {domain} comparing the last {recent_period} to the prior {comparison_period}. Identify pages with the largest click and impression declines. For each declining page, diagnose the likely decay cause (content staleness, competitor improvement, intent shift, or algorithm change) and generate a prioritized refresh action plan...
contentcontent-refreshdecay
Content v1.0

E-E-A-T Page Signal Optimizer

Audits a specific page for E-E-A-T signals and generates concrete copy and structural improvements.

Evaluate the following page content {page_content} from {page_url} for E-E-A-T signals. Score each dimension: Experience (first-hand evidence, original data), Expertise (credential signals, technical depth), Authoritativeness (external citations, named experts), Trustworthiness (source transparency, accuracy markers). For each dimension score below 7/10, provide specific copy edits or structural additions to improve it...
contente-e-a-tquality
Audit v1.0

Faceted Nav Parameter Crawl Audit

Audits faceted navigation URL parameters for crawl waste and duplicate content risk.

Using the crawl export {crawl_csv} for {site_url}, identify all URLs containing query parameters generated by faceted navigation. Classify each parameter type (filter, sort, pagination) and assess its indexing status, duplicate content risk, and crawl volume. Recommend a parameter handling strategy using robots.txt, canonical tags, or GSC parameter tools for each...
auditfaceted-navcrawl-budget
Ranking v1.0

Featured Snippet Format Type Targeter

Identifies the optimal featured snippet format for a keyword set and rewrites content to match.

For each keyword in {keyword_list}, analyze the current featured snippet (if present) and classify its format: paragraph, numbered list, bulleted list, table, or video. Then review the existing content at {page_url} and rewrite the relevant section in the format most likely to capture the snippet for each keyword. Explain your format choice for each...
rankingfeatured-snippetserp
GEO v1.0

GEO Entity Prominence Gap Brief

Identifies entity prominence gaps on a page that reduce LLM recognition and citation likelihood.

Analyze the content of {page_url} for entity prominence signals relevant to the topic {topic}. Identify: (1) entities that are mentioned but not adequately defined or contextualized, (2) key entities missing entirely, and (3) entity relationships that should be made explicit. Output a structured brief with entity additions and content edits to improve LLM citation readiness...
geoentityprominence
Ranking v1.0

Image SERP Structured Data Gap Plan

Audits image pages for structured data and metadata gaps limiting Image SERP feature eligibility.

For the image-heavy page {page_url}, audit all images for the following Image SERP signals: descriptive filename, alt text quality, surrounding text relevance, ImageObject schema presence, license metadata, and page load speed impact. For each image, score current signal strength and provide specific recommendations to improve Image SERP visibility and rich result eligibility...
rankingimage-serpstructured-data
Audit v1.0

Indexing Exclusion Root Cause Audit

Diagnoses root causes for GSC-reported indexing exclusions across crawled and non-crawled URLs.

Review the GSC Coverage report export {coverage_csv} for {site_url}. For each exclusion category (e.g., 'Crawled – currently not indexed', 'Discovered – currently not indexed', 'Excluded by noindex'), group URLs by template type, identify likely root causes, and recommend targeted fixes with validation steps...
auditindexinggsc
GEO v1.0

LLM Recency Freshness Signal Plan

Creates a content freshness strategy to maintain LLM citation relevance as training data ages.

For the content inventory at {domain} covering topic {topic}, identify which pages are at risk of LLM recency decay based on publish date, last-modified date, and topic volatility. For each at-risk page, generate a freshness update plan specifying: data points to refresh, new entities to add, structural improvements, and republish signaling tactics...
geofreshnessllm
GEO v1.0

LLM Source Authority Signal Builder

Generates a plan to strengthen domain-level authority signals that drive LLM source preference.

For the domain {domain} targeting the topic cluster {topic_cluster}, audit the following authority signals that influence LLM source selection: E-E-A-T markers, citation backlink profile, Wikipedia/Wikidata presence, structured data completeness, and author credibility indicators. Output a prioritized 90-day action plan to improve LLM source preference...
geoauthorityllm
GEO v1.0

Multi-LLM Answer Variance Auditor

Compares answers across multiple LLMs for a query to identify brand mention and citation gaps.

Run the query '{target_query}' through ChatGPT, Claude, Perplexity, and Gemini. Record the full response from each. Then: (1) identify which sources are cited in each response, (2) flag where {brand} is mentioned or absent, (3) compare factual claims for consistency, and (4) recommend content changes to improve {brand}'s presence across all four models...
geomulti-llmbrand-mentions
Audit v1.0

Orphan Page Equity Recovery Audit

Finds orphaned pages with ranking potential and maps internal link opportunities to recover them.

Given the crawl export {crawl_csv} and GSC performance data {gsc_csv} for {site_url}, identify all pages receiving zero internal links. Cross-reference with GSC impressions to flag orphans with latent ranking potential. For each, suggest at least two internal link placements with recommended anchor text...
auditorphan-pagesinternal-links
GEO v1.0

Perplexity Citation Profile Builder

Builds a citation signal profile showing why Perplexity does or does not cite a given domain.

Analyze the following Perplexity AI responses for queries in the {topic} niche: {perplexity_responses}. Identify which domains are cited most frequently, what content characteristics those sources share (format, length, entity density, freshness), and where {domain} falls short. Output a citation signal profile with a gap-closing action plan...
geoperplexitycitations
Content v1.0

Programmatic Content Template Auditor

Audits programmatic page templates for thin content risk and recommends dynamic enrichment strategies.

Review the programmatic page template for {template_type} at {domain}, using these sample URLs: {sample_urls}. Assess each template section for: unique value-add per page variant, dynamic content depth, entity specificity, internal linking logic, and structured data completeness. Flag thin content risk patterns and recommend dynamic data integrations or content modules to add unique value at scale...
contentprogrammatictemplate
Technical v1.0

Robots.txt Crawl Waste Optimizer

Analyzes an existing robots.txt file and optimizes directives to reduce crawl waste and fix over-blocking.

Review the current robots.txt file for {site_url}: {robots_txt_content}. Cross-reference disallowed paths with the crawl export {crawl_csv} and GSC coverage data. Identify: (1) valuable pages being incorrectly blocked, (2) low-value path patterns not yet disallowed, and (3) directive syntax errors. Output an optimized robots.txt file with an explanation for each change...
technicalrobots-txtcrawl-budget
Content v1.0

Schema Rich How-To Content Drafter

Drafts a How-To article with embedded HowTo schema markup optimized for rich result eligibility.

Write a complete How-To article on '{how_to_topic}' for the audience {target_audience} at {domain}. Structure the content with: an intro paragraph, a named 'What You'll Need' tools list, and {num_steps} numbered steps each with a clear action verb title, 40-80 word body, and one image suggestion. Output the article body and a corresponding HowTo JSON-LD schema block...
contenthow-toschema
Ranking v1.0

SERP Intent Segment Classifier

Classifies a keyword list by micro-intent type to align content strategy with SERP expectations.

Classify each keyword in the following list {keyword_list} by SERP intent type: informational, navigational, transactional, commercial investigation, or local. For each keyword, also identify the dominant SERP feature present (featured snippet, PAA, local pack, shopping, etc.) and the implied content format Google is rewarding. Output as a structured table...
rankingintentserp
Ranking v1.0

SERP Volatility Cause Mapper

Diagnoses likely causes of SERP position volatility for specific URLs using ranking and algorithm data.

For the URL {page_url} targeting keyword {target_keyword}, analyze the ranking history data {ranking_history_csv} over the past {time_period}. Cross-reference position changes with known algorithm update dates, competitor content changes, and on-page modification history. Classify each volatility event by probable cause and recommend stabilization actions...
rankingvolatilityalgorithm
Technical v1.0

Server-Side Rendering SEO Decision Spec

Creates a rendering decision framework to choose SSR, CSR, or hybrid per page type for SEO.

For {site_url} built on {framework}, evaluate the rendering strategy for each page type in {page_type_list}. For each type, recommend SSR, CSR, SSG, or ISR based on: content update frequency, SEO indexing priority, JavaScript dependency level, and Time to First Byte targets. Output a decision matrix with implementation notes and the expected SEO impact of each recommendation...
technicalrenderingssr
Audit v1.0

Technical Site Audit Scope Planner

Builds a scoped technical audit checklist tailored to site size, CMS, and priority issues.

You are an SEO audit specialist. Given the site URL {site_url}, CMS {cms}, and reported issues {issue_list}, generate a prioritized technical audit checklist covering crawlability, indexing, Core Web Vitals, and structured data. For each item, include the diagnostic tool to use and the expected output format...
audittechnicalchecklist
Content v1.0

Title Meta Batch SERP Rewriter

Rewrites a batch of title tags and meta descriptions to improve CTR based on SERP intent signals.

For each URL in the following list {url_list}, rewrite the title tag and meta description to maximize CTR. Use the current title, meta, and top keyword {keyword} for each page. Apply these rules: title within 60 characters, include primary keyword near front, use a power word or number where relevant; meta within 155 characters, include a clear value proposition and CTA. Output before/after table...
contenttitle-tagsctr
Content v1.0

Topic Cluster Gap Content Mapper

Maps content gaps within an existing topic cluster and prioritizes new supporting page creation.

Review the existing content inventory for the topic cluster '{cluster_topic}' at {domain}: {existing_urls}. Using competitor content analysis and keyword gap data {keyword_gap_csv}, identify supporting subtopics with search demand that are not covered by any existing page. Prioritize gaps by traffic opportunity, internal link benefit, and topical authority contribution. Output a creation roadmap...
contenttopic-clustergap-analysis
Technical v1.0

XML Sitemap Split Priority Engineer

Designs a multi-sitemap index architecture with priority and changefreq values tuned per page type.

Design a sitemap index architecture for {site_url} with {total_url_count} URLs across the following page types: {page_type_list}. For each page type, specify: the dedicated sitemap file name, recommended priority value, changefreq setting, and inclusion/exclusion logic. Output the sitemap index XML and one example sitemap file per page type with proper formatting and lastmod logic...
technicalsitemapcrawl
GEO v1.0

Brand Mention LLM Diagnostic

Diagnoses how and where a brand is mentioned across LLM responses and surfaces sentiment patterns.

Act as a brand GEO analyst. Given these LLM-generated responses mentioning {brand_name} across the queries {query_list}: {llm_response_samples}, classify each mention by sentiment (positive/neutral/negative), context type (comparison, recommendation, definition, example), and accuracy. Identify the top 3 perception gaps and recommend content fixes...
geobrand-mentiondiagnostic
Technical v1.0

CDN Cache Header SEO Spec

Specifies cache-control header rules for CDN configuration to optimize crawl and indexing.

You are a technical SEO and CDN engineer. For {site_url} using {cdn_provider}, specify the optimal Cache-Control, Surrogate-Control, and Vary header configuration for each page template: {page_templates}. Balance crawl freshness for frequently updated pages vs. cache efficiency for static pages. Output a header config table and implementation instructions for {cdn_provider}...
technicalcdncache-headers
GEO v1.0

ChatGPT Entity Citation Gap Brief

Identifies entity and topical gaps preventing ChatGPT from citing a brand or page.

Act as a GEO content strategist. Given that {brand_name} is currently not being cited by ChatGPT for queries related to {topic}, analyze the top 5 sources ChatGPT does cite for these queries: {cited_sources}. Identify the entity associations, content depth, and authority signals {brand_name} is missing and provide a gap-closure brief...
geochatgptentity
GEO v1.0

Citation Context Pre-Publish Signal Checker

Validates citation-worthiness signals in a draft before publishing for LLM indexing.

You are a GEO pre-publish reviewer. Analyze the following draft content for {url}: {draft_content}. Check for presence and strength of: named entities, statistical claims with sources, authoritative external links, structured answer passages, author credentials, and publication date signals. Score each dimension and return a publish-readiness report...
geocitationpre-publish
Technical v1.0

Cloudflare Worker Redirect SEO Spec

Writes a Cloudflare Worker script to handle SEO-safe redirects at the edge.

You are an edge SEO engineer. Write a Cloudflare Worker script that handles the following redirect rules for {site_url}: {redirect_rules_list}. Ensure all redirects return 301 status codes, preserve query strings where specified, handle trailing slash normalization, and include logging for redirect hits. Add inline comments explaining SEO implications of each rule block...
technicalcloudflareedge-seo
Ranking v1.0

Competitor SERP Gap Opportunity Map

Maps keywords where competitors rank but the target site has no SERP presence.

Act as a competitive SEO analyst. Given the keyword ranking data for {competitor_list} and {our_site}, identify all keywords where at least 2 competitors rank in positions 1–20 but {our_site} ranks outside the top 100. Cluster these by topic, filter by search volume >{min_volume}, and output an opportunity map ranked by traffic potential...
rankingcompetitor-gapkeywords
Content v1.0

Content Brief Intent Gap Builder

Generates a content brief that fills intent gaps missed by current top-ranking pages.

Act as a content strategist. For the target keyword '{keyword}', analyze the top 10 ranking pages and identify: questions left unanswered, intent angles unaddressed, and content formats underrepresented. Use these gaps to generate a detailed content brief for {site_url} including target intent, outline, word count, required entities, and differentiation angle...
contentcontent-briefintent
Content v1.0

Content Gap Topical Cluster Finder

Finds topical cluster gaps where a site lacks coverage relative to competitors.

Act as a topical authority analyst. Given the content inventory for {site_url}: {content_inventory} and the topic cluster map for '{core_topic}', identify all subtopics where competitors {competitor_list} have content but {site_url} does not. Rank gaps by topical authority impact and search demand, and output a prioritized content creation roadmap...
contentcontent-gaptopical-authority
Content v1.0

Content Outline EEAT Signal Builder

Structures content outlines with explicit E-E-A-T signals embedded at each section.

You are an E-E-A-T content architect. For the topic '{topic}' targeting {audience}, produce a detailed content outline where each section heading is accompanied by: the specific experience/expertise/authoritativeness/trust signal to embed, the evidence type required (personal experience, cited study, expert quote, credential), and the ideal content format...
contente-e-a-toutline
Audit v1.0

Crawl Budget Template Review

Reviews URL templates consuming crawl budget without delivering indexing value.

Act as a crawl budget optimization expert. Given this crawl log summary for {site_url} showing Googlebot visits by URL pattern: {crawl_log_summary}, identify URL templates that consume >10% of crawl budget but contribute <1% of organic traffic, and recommend robots.txt or noindex directives for each...
auditcrawl-budgetindexing
Content v1.0

EEAT Author Profile Optimizer

Builds a structured E-E-A-T author bio and credential display plan for content pages.

You are an E-E-A-T optimization specialist. Given the author details for {author_name}: {author_credentials}, create an optimized author bio (150–200 words) that prominently signals first-hand experience, subject-matter expertise, and verifiable credentials. Also provide an on-page schema markup plan (Person schema) and a list of off-page authority-building actions...
contente-e-a-tauthor
Content v1.0

FAQ Intent Schema Block Builder

Generates FAQ blocks with schema markup aligned to PAA and voice search intent.

Act as a content and schema specialist. For the topic '{topic}' targeting the keyword '{keyword}', generate 8–10 FAQ question-answer pairs optimized for PAA matching and voice search. For each pair: keep answers under 50 words, use direct answer format, embed target entities, and output both the HTML FAQ section and the corresponding FAQPage JSON-LD schema block...
contentfaqschema
GEO v1.0

GEO Content Entity Depth Brief

Builds a GEO-optimized content brief focused on deepening entity associations for LLM citation.

Act as a GEO content strategist. Create a content brief for {target_topic} designed to maximize LLM citation potential for {brand_name}. Include: primary and secondary entity associations to establish, co-occurrence terms from top-cited sources, recommended passage structures, authoritative external citations to reference, and E-E-A-T signals to embed...
geocontent-briefentity
Ranking v1.0

Image SERP Schema Gap Finder

Finds schema and metadata gaps preventing images from ranking in image SERP features.

You are an image SEO specialist. Audit the following images on {site_url}: {image_url_list}. For each, evaluate alt text quality, surrounding context relevance, file naming, structured data (ImageObject schema), page authority, and original source signals. Output a gap table and prioritized fix recommendations for image SERP visibility...
rankingimage-serpschema
Audit v1.0

Indexing Anomaly Coverage Audit

Diagnoses indexing anomalies from Google Search Console coverage data.

You are an indexing diagnostics expert. Given the following Google Search Console coverage report data for {site_url}: {gsc_coverage_data}, categorize all non-indexed URLs by reason code, identify the top 3 systemic causes, and produce a remediation checklist ordered by impact...
auditindexinggsc
Technical v1.0

INP Interaction Trace Fix Planner

Traces INP interaction delays to their root cause in the main thread execution stack.

You are a Core Web Vitals INP specialist. Given the following Chrome DevTools Performance trace data for {url} showing high INP interactions: {performance_trace}, identify the specific interaction(s) causing INP failures, trace the main thread blocking tasks (long tasks, event handlers, style/layout recalculations), and provide a step-by-step code-level optimization plan to bring INP below 200ms...
technicalinpcore-web-vitals
Ranking v1.0

Knowledge Panel Entity Gap Builder

Identifies missing entity signals needed to trigger or enhance a Knowledge Panel.

You are a Knowledge Graph SEO specialist. For the entity '{entity_name}' of type {entity_type}, audit the current Knowledge Panel state (or lack thereof) and compare against Wikidata, Wikipedia, and Google's structured data for similar entities. List the top 10 missing signals and provide a step-by-step plan to establish or enrich the panel...
rankingknowledge-panelentity
GEO v1.0

LLM Source Preference Drift Report

Tracks shifts in which sources LLMs prefer over time for a target topic.

You are a GEO analyst tracking LLM source drift. Given two sets of LLM citation samples for the topic '{topic}' collected at {date_t1} and {date_t2}: {citation_samples_t1} and {citation_samples_t2}, identify sources that gained or lost citation share, hypothesize why based on content changes, and recommend actions for {brand_name} to maintain or gain citation...
geosource-driftllm
Audit v1.0

Log File Segment Behavior Audit

Analyzes log file segments to surface Googlebot crawl frequency anomalies by URL type.

You are an SEO log file analyst. Given the following log file data for {site_url}, segment bot visits by URL template (e.g. product pages, category pages, blog posts) and identify which segments are over-crawled or under-crawled relative to their PageRank value...
auditlog-filecrawl
GEO v1.0

Multi-LLM Citation Gap Tester

Compares citation patterns across multiple LLMs to find brand visibility blind spots.

You are a multi-LLM GEO analyst. Given these response excerpts from ChatGPT, Claude, Gemini, and Perplexity for the query '{target_query}': {llm_responses}, identify which LLMs cite {brand_name}, which cite competitors, and what content or authority signals differentiate cited vs. uncited sources. Produce a prioritized improvement plan...
geomulti-llmcitation
Audit v1.0

Orphan Page Link Gap Auditor

Detects orphaned pages with zero internal links and recommends link injection points.

You are an internal linking SEO specialist. Given this list of crawled URLs with zero inbound internal links for {site_url}: {orphan_url_list}, cross-reference against the sitemap and analytics data to classify each orphan by type, and recommend the top 3 parent pages to link from for each...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Intent Gap Cluster Builder

Mines People Also Ask data to build intent-mapped content gap clusters.

Act as a content strategist. Given the following PAA questions scraped for the seed keyword '{seed_keyword}': {paa_questions}, group them into intent clusters (informational, navigational, commercial, transactional), identify which clusters {site_url} has no content addressing, and output a prioritized content gap map with recommended page types per cluster...
rankingpaacontent-gap
GEO v1.0

Perplexity Citation Readiness Scorer

Scores a page's structural and content signals for Perplexity citation likelihood.

You are a GEO analyst specializing in Perplexity AI. Review the following page at {url} with content: {page_content}. Score it across 6 citation-readiness dimensions: source authority, factual density, structured formatting, recency signals, entity prominence, and external citation count. Provide a score and improvement action per dimension...
geoperplexitycitation
Content v1.0

Programmatic SEO Content Template Builder

Creates scalable programmatic content templates with variable slots for entity-based pages.

You are a programmatic SEO architect. For the page type '{page_type}' (e.g., '{example_page}') on {site_url}, design a content template that: defines static copy blocks, dynamic variable slots ({variable_examples}), entity injection points, internal link logic, and schema markup. Ensure the template produces unique, indexable value at scale without thin content risk...
contentprogrammatictemplate
Technical v1.0

Robots.txt Crawl Budget Architect

Designs robots.txt directives to protect crawl budget by blocking low-value URL patterns.

You are a technical SEO engineer. Given the following URL structure and crawl log data for {site_url}: {url_patterns} and {crawl_data}, generate an optimized robots.txt file that: blocks faceted navigation parameters, session IDs, internal search URLs, and duplicate content paths while ensuring all priority page templates remain crawlable. Include inline comments explaining each directive...
technicalrobots-txtcrawl
Audit v1.0

Schema Type Gap Audit Runner

Identifies missing or incomplete schema markup types across key page templates.

Act as a structured data specialist. Review the following list of page types for {site_url}: {page_types}. For each, identify which Schema.org types are missing, partially implemented, or incorrectly nested, and output a prioritized fix list with example JSON-LD snippets...
auditschemastructured-data
Technical v1.0

Security Headers SEO Risk Analyzer

Analyzes HTTP security headers for configurations that create SEO rendering or crawl risks.

You are a technical SEO and security engineer. Given the following HTTP response headers for {site_url}: {response_headers}, identify any Content-Security-Policy, X-Frame-Options, HSTS, or Permissions-Policy directives that could: block Googlebot from rendering JS/CSS, cause iframe embedding issues for rich results, or create HTTPS/HTTP mixed content problems. Output a risk table with severity ratings and safe configuration recommendations...
technicalsecurity-headersseo
Ranking v1.0

SERP Volatility Cause Tracker

Correlates ranking volatility spikes with algorithm updates, site changes, or SERP feature shifts.

You are an SEO volatility analyst. Given the following ranking history data for {site_url} over the period {date_range}: {ranking_data}, identify dates with >15% ranking position fluctuation, correlate each spike with known algorithm updates, site change logs ({change_log}), and SERP feature changes. Output a cause-attribution report with confidence scores...
rankingvolatilityalgorithm
Technical v1.0

Sitemap Index Split Architecture

Designs a sitemap index architecture splitting large sites into logical, crawlable sub-sitemaps.

Act as a sitemap architecture engineer. For {site_url} with {total_url_count} URLs across page types: {page_type_breakdown}, design a sitemap index architecture. Specify: individual sitemap files by page type, URL count per file (max 50K), update frequency signals, lastmod date strategy, priority assignments, and the sitemap index XML structure. Flag any URL types that should be excluded from sitemaps with rationale...
technicalsitemapcrawl
GEO v1.0

Source Authority Citation Model

Models the authority signals that make a source preferred by LLMs for a given topic.

You are a source authority GEO analyst. Given the following list of sources consistently cited by LLMs for the topic '{topic}': {cited_sources_list}, reverse-engineer the common authority signals (domain age, backlink profile, content depth, structured data, author credentials) and produce a model {brand_name} can use to close the authority gap...
geosource-authorityllm
Technical v1.0

SSR Hydration SEO Gap Checker

Identifies content visible post-hydration but missing from SSR HTML that Googlebot indexes.

Act as a JavaScript SEO engineer. Given the SSR HTML output and post-hydration DOM snapshot for {url}: {ssr_html} and {hydrated_dom}, perform a content delta analysis. Identify all text, links, meta tags, and structured data present in the hydrated DOM but absent from the SSR HTML. Flag items critical for indexing and provide SSR rendering fixes for each...
technicalssrjavascript
Audit v1.0

Technical Site Crawl Audit Planner

Generates a structured crawl audit plan identifying key technical issues across a site.

Act as a senior SEO engineer. Given the site {site_url}, produce a prioritized technical crawl audit plan covering crawlability, indexability, status codes, and redirect chains. For each issue found, provide severity rating, root cause, and recommended fix...
auditcrawltechnical
GEO v1.0

AI Mode Passage Retrieval Optimizer

Rewrites content sections to maximize passage-level retrieval in Google AI Mode responses.

Analyze the following content page for {url}: {page_content}. Identify the top 5 passages most likely to be retrieved by Google AI Mode for the target query '{query}'. Rewrite each passage to improve: semantic density, answer-completeness, entity specificity, and structural clarity. Show before/after versions with annotations explaining each change...
geoai-modepassage-retrieval
GEO v1.0

AI Overview Entity Salience Scorer

Scores how prominently {brand} entities appear in AI Overview responses for target queries.

For each query in the following set: {query_list}, retrieve or simulate the AI Overview response and score the salience of {brand} on a 0–10 scale based on: mention position, mention frequency, semantic proximity to the answer core, and presence of brand-specific facts. Output a ranked table with improvement recommendations...
geoai-overviewentity
Content v1.0

Anchor Text Diversity Audit Planner

Analyzes internal anchor text distribution for {target_url} and prescribes a diversification plan.

Using the following internal link export for {site}: {internal_link_csv}, filter all links pointing to {target_url}. Categorize each anchor by type (exact-match, partial-match, branded, generic, naked URL). Calculate distribution percentages, compare against natural anchor diversity benchmarks, flag over-optimized anchor types, and produce a re-anchor plan specifying which anchor texts to change and to what alternatives...
contentanchor-textinternal-links
GEO v1.0

Brand Mention Coverage Gap Finder

Finds high-authority pages mentioning competitors but not {brand} and prioritizes outreach targets.

Using the following list of high-authority URLs that mention {competitor} but not {brand}: {url_list}, analyze each page's topic relevance, domain authority, and mention context. Rank outreach targets by LLM citation probability uplift and draft a one-sentence pitch for each explaining why {brand} should be referenced on that page...
geobrand-mentionsoutreach
Technical v1.0

CDN Cache SEO Header Configurator

Prescribes CDN cache-control and Vary header rules that balance SEO crawlability with caching efficiency.

Audit the following CDN response headers for key URL templates on {site}: {header_samples}. For each URL template, evaluate Cache-Control (max-age, stale-while-revalidate), Vary headers, ETag/Last-Modified presence, and X-Robots-Tag consistency. Flag configurations that may cause Googlebot to receive stale or incorrect content, and provide corrected header rules for your CDN platform: {cdn_platform}...
technicalcdncaching
GEO v1.0

ChatGPT Entity Readiness Brief

Evaluates whether {brand} has the entity signals needed to be cited confidently by ChatGPT.

Audit the following brand signals for {brand}: {signal_data}. Score entity readiness for ChatGPT citation across these dimensions: Wikipedia/Wikidata presence, consistent NAP across authoritative sources, Knowledge Graph recognition, press coverage recency, and structured data on {brand_domain}. Provide a gap-fix action plan ranked by citation impact...
geochatgptentity
GEO v1.0

Citation Signal Pre Publish Scorer

Scores a draft article against LLM citation criteria before publication and flags gaps.

Score the following draft article for LLM citation readiness: {article_draft}. Evaluate against these criteria: factual specificity (unique data/stats), entity density (named entities per 100 words), source credibility signals (author bio, citations, publication), structural retrievability (headings, concise answers), and topical completeness. Output a score per criterion and a prioritized revision checklist...
geocitationpre-publish
Technical v1.0

Cloudflare Worker SEO Rule Builder

Writes a Cloudflare Worker script implementing edge SEO rules for {site} without origin server changes.

Write a Cloudflare Worker script for {site} that implements the following edge SEO rules: {rule_list}. Rules may include: injecting canonical tags, modifying response headers (X-Robots-Tag, Cache-Control), rewriting redirect chains to single hops, and serving alternate hreflang headers. The script must handle all rules within a single fetch event listener and include error handling and logging...
technicaledge-seocloudflare
Ranking v1.0

Competitor Ranking Gap Opportunity Map

Finds keywords where top competitors rank in positions 1–10 but {site} is absent or below position 20.

Using the following keyword ranking export for {site} and competitors {competitor_list}: {ranking_data_csv}, identify all keywords where at least two competitors rank in positions 1–10 and {site} ranks below position 20 or not at all. Group gaps by topic cluster, estimate traffic opportunity, and for each cluster recommend the content type and on-page strategy to close the gap...
rankingcompetitor-gapopportunity
Content v1.0

Content Brief SERP Feature Targeting

Builds a content brief engineered to capture multiple SERP features for a target keyword.

Create a full content brief for the target keyword '{keyword}' on {site}. The brief must include: target SERP features (featured snippet, PAA, rich result types), required headings mapped to PAA questions, optimal content length and format, E-E-A-T signals to include (author credentials, first-hand experience cues, citations), semantic entities to mention, and a content outline with section-level word counts...
contentcontent-briefserp-features
Content v1.0

Content Outline Entity Enricher

Enhances a draft content outline by injecting missing semantic entities and NLP-relevant terms.

Review the following draft content outline for the topic '{topic}': {outline_draft}. Using NLP entity analysis, identify the top 20 semantic entities and LSI terms that top-ranking pages for this topic include but the outline omits. For each missing entity, specify the section where it should be integrated, the recommended sentence or heading context, and why its inclusion improves topical authority...
contententityoutline
Content v1.0

Content Refresh Traffic Decay Scorer

Scores decaying content pages by traffic loss rate and ROI of refresh effort to prioritize updates.

Using the following GSC performance data for {site}: {gsc_export_csv}, identify all URLs showing >20% click decline over the past 6 months. For each, calculate: decline rate, peak traffic, estimated monthly traffic loss, keyword position drift, and content age. Score refresh ROI using a formula weighting traffic potential vs effort, and output a ranked refresh queue with the top change needed per URL...
contentcontent-refreshdecay
Content v1.0

E-E-A-T Author Credential Optimizer

Audits author bio pages and byline signals on {site} and rewrites them to maximize E-E-A-T signals.

Review the following author bio pages from {site}: {bio_urls}. For each, score current E-E-A-T signals: demonstrated first-hand experience, credentials and qualifications, external recognition (publications, awards), social proof links, and on-page schema (Person markup). Provide a rewritten bio template for each author that maximizes E-E-A-T signaling without keyword stuffing...
contente-e-a-tauthor
Content v1.0

FAQ Schema Intent Block Writer

Generates a PAA-aligned FAQ section with embedded FAQPage JSON-LD for a target landing page.

For the target page '{page_url}' targeting the keyword '{keyword}', generate a complete FAQ section of 8–12 questions drawn from People Also Ask and related searches. Each answer must be 40–60 words, directly answer the question, and naturally include a secondary keyword. Append a valid FAQPage JSON-LD block encoding all questions and answers...
contentfaqschema
Ranking v1.0

Featured Snippet Format Gap Finder

Identifies queries where {site} ranks in top 5 but loses the featured snippet due to format mismatch.

Using the following list of queries where {site} ranks positions 1–5 but does not hold the featured snippet: {query_rank_data}, analyze the current snippet winner for each query. Identify the snippet format (paragraph, list, table, code), compare to {site}'s current content format, and provide specific markup and copy changes to capture each snippet...
rankingfeatured-snippetserp
GEO v1.0

Generative SERP Topic Gap Brief

Identifies topic angles covered in generative SERP features where {brand} has no retrievable content.

For the topic cluster '{topic_cluster}', analyze current AI Overview and Google AI Mode responses. List every sub-topic or question angle that appears in generative features but for which {brand_domain} has no indexable content. Produce a prioritized content gap brief for each missing angle including target query, recommended format, required entities, and word-count estimate...
geogenerative-serpcontent-gap
Technical v1.0

Hreflang XML Sitemap Locale Generator

Generates a complete hreflang sitemap for {site} covering all locale variants with return tag validation.

Using the following locale URL mapping table for {site}: {locale_url_table}, generate a complete XML sitemap incorporating hreflang annotations for all locale variants. Ensure every URL includes xhtml:link entries for all locales including x-default. Validate that return tags are symmetrical. Output the full XML and flag any locale pairs where a canonical URL is missing...
technicalhreflangsitemap
GEO v1.0

GEO Brief Source Authority Builder

Creates a content brief engineered to meet LLM source authority signals for a target topic.

Create a GEO-optimized content brief for the topic '{topic}' targeting citation by large language models. The brief must specify: required authoritative sources to cite, entity co-occurrence targets, statistical claim requirements, ideal content structure for LLM passage retrieval, and a checklist of credibility signals (author credentials, publication date, external citations)...
geocontent-briefllm
Audit v1.0

Indexing Exclusion Reason Classifier

Classifies GSC 'not indexed' reasons into actionable fix groups with priority scores.

Below is a Google Search Console index coverage export for {site}: {gsc_csv}. Group each excluded URL by its exclusion reason, calculate the percentage share of total exclusions, estimate traffic opportunity lost (using provided keyword data), and output a prioritized fix roadmap with specific remediation steps for each reason group...
auditindexinggsc
Technical v1.0

INP Interaction Event Trace Fixer

Diagnoses high INP scores by tracing interaction event delays to specific JS tasks and proposes fixes.

Analyze the following Chrome DevTools Performance trace and CrUX INP field data for {url}: {trace_data}. Identify the interaction events (click, keypress, tap) contributing to INP >200ms. For each event, trace the delay to: main-thread blocking tasks, long tasks, input delay sources, and presentation delay. Provide specific code-level fixes (debouncing, task splitting, scheduler.yield()) for each identified bottleneck...
technicalinpcore-web-vitals
Audit v1.0

Internal Link Depth Flow Audit

Measures click depth and PageRank flow distribution across internal link graph for {site}.

Using the internal link adjacency data below for {site}: {link_graph_csv}, calculate click depth from the homepage for each URL, identify pages beyond depth 4, and surface the top 20 high-priority pages (by organic traffic or ranking) that are buried deepest. Recommend structural changes to reduce depth...
auditinternal-linkspagerank
Technical v1.0

JSON-LD Schema Validator Repair

Audits a JSON-LD block for errors against schema.org and Google's rich result requirements and fixes them.

Review the following JSON-LD block from {url}: {json_ld_code}. Validate it against schema.org specifications and Google's Rich Results eligibility rules for the declared @type. List every error, warning, and recommended enhancement. Then output a fully corrected JSON-LD block with inline comments explaining each fix...
technicaljson-ldschema
Ranking v1.0

Knowledge Panel Signal Gap Fixer

Identifies missing entity signals preventing or degrading {brand}'s Google Knowledge Panel.

Audit the following brand entity signals for {brand}: {signal_inventory}. Compare against Google Knowledge Panel eligibility requirements: Wikidata entity, Wikipedia article, consistent sitelinks, structured data on homepage, authoritative third-party mentions. Flag each missing signal, rate its impact on panel appearance (high/medium/low), and provide a specific acquisition action...
rankingknowledge-panelentity
GEO v1.0

LLM Source Freshness Gap Optimizer

Identifies {brand} content that LLMs may deprioritize due to staleness and prescribes refresh actions.

Review the following {brand} content inventory: {content_list}. For each piece, score freshness risk based on: publication date, last-updated date, presence of dated statistics, and topic recency sensitivity. Flag items where LLMs are likely to prefer fresher competitor content, and provide a specific refresh action (update stat, add section, republish) for each high-risk piece...
geofreshnesscontent-refresh
Ranking v1.0

Local Pack Signal Strength Auditor

Scores the local pack ranking signals for {business} against top-3 local pack competitors.

For the query '{local_query}' in {location}, compare {business} against the current top-3 local pack results across these signal categories: GBP completeness, review count and velocity, citation consistency (NAP), proximity, category relevance, website LocalBusiness schema, and on-page local signals. Score each signal 1–10, compute weighted totals, and produce a prioritized improvement plan...
rankinglocal-packgbp
Audit v1.0

Log File Segment Pattern Mapper

Analyzes server log segments to surface Googlebot crawl patterns, gaps, and waste by URL template.

Using the server log excerpt below for {site}, segment all Googlebot requests by URL template (e.g., /blog/*, /product/*). For each segment report: crawl frequency, average response code, cache-hit ratio, and crawl-to-index ratio. Flag any template with >20% 4xx or 5xx responses...
auditlog-filecrawl
Audit v1.0

Mobile First Content Parity Check

Compares desktop vs mobile-rendered HTML to detect content, structured data, or link parity gaps.

Compare the following desktop-rendered HTML and mobile-rendered HTML snapshots for {url}: {desktop_html} vs {mobile_html}. List every element present on desktop but absent on mobile (text, links, structured data, images, headings). Classify each gap by SEO severity (critical/high/medium/low) and suggest fixes...
auditmobile-firstrendering
Ranking v1.0

News SERP Freshness Signal Builder

Prescribes technical and editorial signals to improve {site}'s inclusion in News SERP and Top Stories.

Audit {site} against Google News and Top Stories eligibility criteria. Review the following signals: NewsArticle schema implementation, byline and dateline markup, publication frequency, AMP status, site reputation signals, and robots.txt news directives. For each signal, report current status, gap severity, and the exact implementation change required to improve Top Stories eligibility...
rankingnews-serpfreshness
Technical v1.0

Prerender SEO Config Spec Builder

Builds a prerendering configuration spec for {site} covering bot detection, URL rules, and caching.

Design a prerendering configuration spec for {site} using {prerender_service} (e.g., Prerender.io, Rendertron, or custom). The spec must define: bot user-agent detection logic, URL inclusion and exclusion rules, cache TTL per content type, cache invalidation triggers, and fallback behavior on render failure. Include a testing checklist to verify correct HTML delivery to Googlebot versus real users...
technicalprerenderingrendering
Audit v1.0

Orphan Page Link Opportunity Finder

Identifies orphaned URLs with ranking potential and recommends internal link insertion points.

Given the following list of orphan pages (URLs receiving zero internal links) for {site}: {orphan_url_list}, and the sitemap of existing linked pages, match each orphan to the top 3 most contextually relevant linked pages where an internal link could be naturally inserted. Provide anchor text suggestions and justification...
auditorphan-pagesinternal-links
GEO v1.0

Multi LLM Answer Variance Profiler

Compares how ChatGPT, Claude, Gemini, and Perplexity answer {query} and surfaces brand inclusion gaps.

Run the following query through ChatGPT-4o, Claude 3.5, Gemini 1.5 Pro, and Perplexity: {query}. For each LLM record: exact answer text, sources cited, mention of {brand}, sentiment toward {brand}, and factual accuracy. Produce a cross-LLM comparison matrix and identify which LLM represents the highest visibility risk or opportunity for {brand}...
geomulti-llmbrand-visibility
Content v1.0

Programmatic Content Schema Seeder

Generates a scalable content and schema template for {programmatic_page_type} at volume.

Design a programmatic content template for {programmatic_page_type} pages on {site}. The template must include: a dynamic H1 formula, intro paragraph structure with entity slots, a data table block, an FAQ block (minimum 5 Q&As), a structured data template (specify schema type and all required properties with variable placeholders), and internal link slot logic. Ensure each page achieves minimum viable unique content at scale...
contentprogrammaticschema
Audit v1.0

Redirect Chain Loop Detector

Traces redirect paths to identify chains longer than 2 hops and circular loops costing crawl budget.

Analyze the following redirect map for {site}: {redirect_map}. Identify all chains longer than 2 hops, flag any circular redirects, and for each issue provide: the full hop sequence, HTTP status codes at each hop, estimated PageRank dilution, and a recommended single-hop fix...
auditredirectscrawl-budget
Ranking v1.0

SERP Intent Cluster Classifier

Classifies a keyword list by SERP intent type and maps each to the optimal content format.

Classify each keyword in the following list by dominant SERP intent (informational, navigational, commercial, transactional) and sub-intent (how-to, comparison, definition, local, etc.): {keyword_list}. For each keyword, specify the intent type, evidence from the current SERP (feature types present), and the optimal content format and page type to target...
rankingintentserp
Ranking v1.0

SERP Volatility Cause Root Analyzer

Diagnoses the root cause of ranking volatility for {site} across a specified date range.

Analyze the following ranking position history for {site} from {start_date} to {end_date}: {ranking_history_csv}. Identify all URLs with >5 position swings in the period. For each volatile URL, correlate the movement with: algorithm update dates, competitor content changes, SERP feature appearances, and on-page change log data ({change_log}). Output a root-cause classification for each volatile cluster...
rankingvolatilitydiagnosis
Content v1.0

Schema Rich How-To Content Generator

Drafts a complete how-to article with embedded HowTo JSON-LD optimized for rich results.

Write a complete how-to article titled '{how_to_title}' for {site}. The article must include: an intro establishing E-E-A-T (first-person experience cue, credential mention), numbered steps with a tool/supply list, a tips section, and a FAQ block. Append a valid HowTo JSON-LD block with all steps, estimated time, supply list, and image placeholders. Optimize the meta title and description for the target query '{target_query}'...
contenthow-torich-results
Technical v1.0

Server Side Rendering SEO Config Audit

Validates that {site}'s SSR implementation correctly delivers SEO-critical HTML to Googlebot.

Audit the SSR implementation on {site} using the following evidence: raw HTML response headers, view-source HTML, and rendered DOM from {url_samples}. Verify that all SEO-critical elements (title, meta description, canonical, structured data, body text, internal links) are present in the raw HTTP response and not injected client-side. Flag any element rendered only after JavaScript execution and recommend SSR hydration fixes...
technicalssrrendering
Ranking v1.0

Video SERP Schema Opportunity Mapper

Maps {site}'s video content to VideoObject schema requirements and flags missing rich-result signals.

For the following video pages on {site}: {video_url_list}, audit each against Google's VideoObject schema requirements: name, description, thumbnailUrl, uploadDate, duration, contentUrl/embedUrl, and hasPart for key moments. Flag every missing or malformed property, generate corrected JSON-LD for the top 5 priority videos, and estimate rich-result eligibility for each...
rankingvideo-serpschema
Technical v1.0

XML Sitemap Priority Split Engineer

Designs a split sitemap index architecture for {site} that prioritizes crawl of high-value URLs.

Using the following URL inventory for {site}: {url_inventory_csv}, design a sitemap index architecture that splits URLs into logical sub-sitemaps by content type and crawl priority tier. For each sub-sitemap specify: filename, URL inclusion criteria, expected size, changefreq and priority values per URL type, and a submission schedule recommendation for Google Search Console...
technicalsitemapcrawl-budget
GEO v1.0

AI Mode Query Cluster Fit

Evaluates which of {domain}'s pages are best positioned to appear in Google AI Mode responses.

For the query cluster {cluster}, test AI Mode responses in Google and record the URLs surfaced. Compare those URLs' content characteristics (depth, format, entity coverage, freshness) against {domain}'s competing pages. Produce a fit-gap report and a prioritized list of page improvements to increase AI Mode visibility...
geoai-modevisibility
GEO v1.0

AI Overview Freshness Gap Audit

Identifies content freshness gaps that prevent {domain} pages from being cited in AI Overviews.

For the query set {queries}, retrieve current AI Overview responses and compare the publication dates and last-modified signals of cited sources against {domain}'s competing pages. List each freshness gap and recommend specific content update actions to improve AI Overview citation eligibility...
geoai-overviewfreshness
GEO v1.0

Brand Mention Coverage Gap Map

Maps where {brand} is mentioned vs absent across LLM responses for priority query clusters.

Using the LLM response log provided for {brand}, identify all query clusters where the brand receives zero mentions. For each gap cluster, analyze the top-mentioned brands to determine the content attributes (format, depth, recency, source type) that drive their inclusion. Produce a gap map with recommended content actions...
geobrand-mentiongap-analysis
Audit v1.0

Canonical Tag Chain Audit

Finds canonical tags that point to non-canonical or redirecting URLs, creating signal confusion.

Review the canonical tag export for {domain} below. Identify all cases where a canonical URL is itself redirected, non-indexable, or points to a different canonical, forming a canonical chain. Produce a fix list with the corrected self-referencing or final-destination canonical for each affected URL...
auditcanonicalstechnical
GEO v1.0

ChatGPT Entity Prominence Scorer

Scores how prominently ChatGPT surfaces {brand} as an entity when answering category queries.

Run the following 15 category-level queries in ChatGPT and record every brand or entity mentioned per response. Score {brand}'s prominence on a 1–5 scale per query based on mention order, frequency, and sentiment. Aggregate scores and identify the query types where {brand} is under-represented...
geochatgptentity
Content v1.0

Content Brief SERP Parity Builder

Builds a content brief that matches the topic depth and format of current first-page SERP results.

Analyze the top 10 organic results for {keyword}. Extract: average word count, heading structure depth, use of lists/tables/visuals, question coverage, and entity mentions. Then generate a detailed content brief for {domain} that meets or exceeds the median benchmark across each dimension, including a recommended outline...
contentbriefserp
Content v1.0

Content Gap Priority Ranker

Ranks content gaps by traffic opportunity, business value, and content creation effort.

Given the content gap list for {domain} versus competitors {competitor_list}, score each gap on three dimensions: estimated monthly organic traffic opportunity (using volume × CTR model), business alignment score (1–5, provided by user), and estimated content production effort (Low/Medium/High). Output a ranked priority matrix with recommended content type for each gap...
contentgap-analysisprioritization
Content v1.0

Content Outline Entity Signals

Structures a content outline that incorporates required entity co-occurrences for topical authority.

For the target keyword {keyword} and topic {topic}, identify the top 10 entities that appear most frequently in first-page content using the page data provided. Structure a content outline where each H2/H3 section is mapped to at least one required entity or entity relationship. Flag sections where entity density is currently below benchmark...
contententityoutline
Content v1.0

Content Refresh Traffic Triage

Triages decaying content by traffic loss rate and ranks pages for immediate refresh attention.

Analyze the 12-month organic traffic trend for each URL in the content inventory of {domain}. Identify pages with consistent month-over-month traffic decline over 3+ months. For each declining page, calculate the annualized traffic loss, estimate recoverable traffic with a refresh, and classify the likely decay cause (freshness, SERP intent shift, cannibalization, or link decay)...
contentcontent-decayrefresh
Technical v1.0

Edge SEO Header Rules Spec

Writes Cloudflare Worker or edge middleware rules to inject or modify SEO-critical HTTP headers.

Write a Cloudflare Worker script for {domain} that: (1) injects canonical link headers on all paginated URLs matching {pattern}, (2) sets X-Robots-Tag: noindex on URLs matching {noindex_pattern}, and (3) adds security headers (Strict-Transport-Security, X-Content-Type-Options, Referrer-Policy) to all responses. Include inline comments explaining each rule...
technicaledge-seocloudflare
GEO v1.0

Generative SERP Passage Optimizer

Rewrites key content passages to match the sentence-level patterns favored in generative SERP extractions.

Analyze the AI Overview or generative SERP extracts for the query {query} and identify the linguistic patterns used (sentence length, claim structure, hedging language, numeric specificity). Rewrite the following passage from {url} to match those patterns while preserving factual accuracy, maximizing the likelihood of passage-level extraction...
geogenerative-serppassage
Audit v1.0

Image SEO Coverage Audit

Audits images across key templates for missing alt text, oversized files, and missing structured data.

Analyze the image inventory for {domain} provided below. For each image, flag: missing or empty alt text, file size above 100 KB without next-gen format, absence of structured data (ImageObject), and non-descriptive filenames. Produce a prioritized remediation table...
auditimagesalt-text
Audit v1.0

Indexing Exclusion Reason Audit

Categorizes Google Search Console indexing exclusions and prioritizes the highest-impact fixes.

Given the Google Search Console coverage report data for {domain}, categorize all non-indexed URLs by exclusion reason (Crawled – not indexed, Duplicate, Blocked by robots.txt, etc.). Rank each category by volume and estimated traffic opportunity, then prescribe the highest-priority fix for each...
auditindexinggsc
Ranking v1.0

Keyword Cannibalization Intent Fix

Resolves cannibalization by reassigning intent ownership and recommending canonical or merge actions.

Review the cannibalization report for {domain} below. For each cannibalizing URL pair, determine which URL better satisfies the dominant search intent for the target keyword. Recommend one of: canonical consolidation, 301 redirect merge, content differentiation, or internal link adjustment — with a one-line rationale for each decision...
rankingcannibalizationintent
Ranking v1.0

Knowledge Panel Gap Builder

Identifies missing or weak knowledge panel attributes for {brand} and prescribes structured data fixes.

Audit the current Google Knowledge Panel for {brand}. List every standard attribute (description, logo, founded date, headquarters, social profiles, products/services) and mark each as Present, Weak, or Missing. For each missing or weak attribute, specify the exact structured data type, Wikidata property, or on-page signal needed to strengthen it...
rankingknowledge-panelentity
GEO v1.0

LLM Source Authority Signal Audit

Audits which authority signals correlate with a domain being cited by LLMs for a given topic.

Analyze the 30 most frequently cited domains for the topic {topic} across ChatGPT, Claude, and Perplexity. For each domain, record: Domain Rating, topical content depth, recency of top cited page, use of structured data, and presence on Wikipedia/Wikidata. Identify which signals most strongly predict LLM citation and score {domain} against them...
geoauthorityllm
Ranking v1.0

Local Pack Competitor Signal Map

Maps the GBP and on-page signals of local pack winners for a target category and location.

For the query {query} in {location}, list the three local pack results and audit each for: GBP category accuracy, review count and average rating, citation consistency (NAP), proximity to search centroid, and on-page local keyword usage. Compare against {brand}'s GBP and produce a ranked action list to close the gap...
rankinglocal-packgbp
Audit v1.0

Log File Crawl Frequency Map

Analyzes server log data to map Googlebot crawl frequency by URL template and section.

Analyze the following server log export for {domain} and segment Googlebot hits by URL pattern (e.g., /blog/, /product/, /category/). Produce a crawl-frequency table showing hits per day, % of total crawl budget consumed, and over- or under-crawled sections...
auditlog-filecrawl-budget
Audit v1.0

Mobile-First Parity Checker

Compares desktop vs mobile-rendered HTML to surface content, markup, or metadata parity gaps.

Compare the desktop and mobile-rendered HTML snapshots of {url} provided below. List every discrepancy in body content, structured data, meta tags, and internal links between the two versions, and classify each discrepancy by SEO severity (High / Medium / Low)...
auditmobile-firstrendering
GEO v1.0

Multi-LLM Source Overlap Matrix

Compares which sources each major LLM cites for the same query to find citation blind spots.

For each query in {query_list}, record the cited or referenced sources from ChatGPT, Claude, Perplexity, and Gemini. Build a matrix showing source overlap across LLMs. Highlight sources cited by 3+ LLMs (high authority) and sources cited by only one (LLM-specific preferences). Recommend content angles to achieve multi-LLM citation...
geomulti-llmcitation
Ranking v1.0

PAA Question Intent Cluster

Groups People Also Ask questions by intent micro-cluster to guide content and FAQ strategy.

Collect all People Also Ask questions triggered by the seed keyword {keyword} across the first three SERP pages. Group questions into intent micro-clusters (e.g., definitional, how-to, comparison, troubleshooting). For each cluster, recommend whether to address it via a new FAQ section, a dedicated page, or a content module within an existing page...
rankingpaaintent
GEO v1.0

Perplexity Citation Format Profiler

Profiles the structural and linguistic patterns of pages Perplexity most frequently cites for a topic.

Examine the top 20 sources cited by Perplexity for the topic {topic}. Identify recurring structural patterns (headers, lists, tables, sentence length), citation anchor phrases, content depth signals, and domain authority markers. Summarize the ideal page template to maximize Perplexity citation probability...
geoperplexitycitation
Content v1.0

Programmatic SEO URL Template Design

Designs scalable URL and content templates for programmatic SEO pages targeting long-tail queries.

Design a programmatic SEO template for {domain} targeting the query pattern {pattern} (e.g., 'best {service} in {city}'). Specify: URL slug structure, dynamic content variables, static content sections required for quality, minimum word count per page, required schema type, internal linking rules, and deduplication logic to prevent thin/duplicate content penalties...
contentprogrammatic-seotemplate
Technical v1.0

Robots.txt Crawl Budget Spec

Drafts optimized robots.txt directives to protect crawl budget from low-value URL patterns.

Given the crawl waste analysis for {domain} (low-value URL patterns: {patterns}), draft a robots.txt file that blocks Googlebot from crawling these patterns while preserving access to all indexable content. Include comments explaining each directive, and flag any pattern where noindex meta tag would be safer than robots.txt disallow...
technicalrobots-txtcrawl-budget
Technical v1.0

Schema Markup Rich Result Generator

Generates complete, validated JSON-LD markup for a specified schema type and page context.

Generate complete JSON-LD structured data markup for a {schema_type} page at {url}. Use the following page details: {page_details}. Ensure all required and recommended properties per Schema.org and Google's Rich Results guidelines are populated. Include a validation checklist confirming each required field is present...
technicalschemajson-ld
Technical v1.0

Security Header CSP SEO Spec

Designs a Content Security Policy that secures {domain} without blocking SEO-critical scripts or resources.

Draft a Content-Security-Policy header for {domain} that: (1) blocks execution of unauthorized inline scripts without breaking structured data JSON-LD blocks or analytics tags, (2) allows all required first-party and approved third-party origins, and (3) does not interfere with Googlebot's ability to render JavaScript. Include a report-only mode directive for safe rollout and a testing checklist...
technicalsecurity-headerscsp
Technical v1.0

Server-Side Render SEO Config

Specifies SSR configuration requirements to ensure full SEO-critical content is in the initial HTML.

For the {framework} application at {domain}, specify the SSR configuration needed to ensure: (1) all SEO-critical content (title, meta, H1, body text, structured data, internal links) is present in the initial server-rendered HTML, (2) hydration does not remove or alter SEO elements, and (3) Googlebot receives the same HTML as users. Include code-level configuration examples...
technicalssrrendering
Ranking v1.0

Shopping Feed SERP Gap Audit

Audits product feed attributes against top Shopping SERP listings to identify ranking gaps.

Compare the Google Merchant Center feed attributes for {product_set} against the top 5 Shopping SERP listings for {query}. Identify gaps in title keyword usage, GTIN presence, price competitiveness, review count, and image quality. Output a prioritized feed optimization checklist...
rankingshopping-serpfeed
Content v1.0

Topic Cluster Spoke Map

Maps spoke pages needed to support a pillar page and assigns keyword targets to each spoke.

Given the pillar topic {topic} and the existing content inventory for {domain}, identify the 10–15 spoke subtopics needed for a complete cluster. For each spoke, assign a primary keyword, estimated search volume, recommended content format, and the specific internal link anchor text to use when linking from the pillar page...
contenttopic-clusterpillar
Technical v1.0

XML Sitemap Segmentation Plan

Designs a sitemap index architecture segmenting URLs by type, priority, and update frequency.

Design a sitemap index architecture for {domain} with an estimated {url_count} indexable URLs. Segment child sitemaps by content type (e.g., pages, posts, products, images, video). For each child sitemap, specify: filename, estimated URL count, recommended changefreq values, priority score logic, and exclusion rules for non-indexable URLs...
technicalsitemaparchitecture
GEO v1.0

AI Mode Featured Query Planner

Plans which queries are most likely to surface in AI Mode and how to optimize content for them.

Given the keyword set {keyword_list} for {brand_domain}, identify which queries are most likely to trigger AI Mode responses based on intent type, query complexity, and topic breadth. For each high-probability query, recommend the content format and passage structure most likely to be featured...
geoai-modequery-planning
GEO v1.0

AI Overview Passage Match Scorer

Scores how well existing page passages align with AI Overview retrieval triggers for target queries.

For each query in {query_list}, retrieve the current AI Overview text and compare it against the corresponding page at {page_url}. Score each page on passage alignment (0–100) across directness, entity coverage, and reading-level match. Output a ranked list with specific rewrite recommendations for low-scoring passages...
geoai-overviewpassage-optimization
Content v1.0

Anchor Text Diversity Audit Plan

Audits internal anchor text distribution for over-optimization or under-diversity and prescribes fixes.

Analyze the internal link anchor text distribution for {target_url} across all inlinking pages on {site_url}. Identify over-optimized exact-match anchors, generic anchors (click here, read more), and missing topically relevant anchor variations. Output a rebalancing plan with specific replacement anchor text for each link to edit...
contentanchor-textinternal-links
GEO v1.0

Brand LLM Source Preference Audit

Tracks which third-party sources LLMs prefer over a brand's own site and diagnoses why.

For the queries in {query_list}, record which sources ChatGPT and Perplexity cite instead of {brand_domain}. For each preferred third-party source, analyze the content attributes (structure, depth, entity density, recency) that make it preferred. Output a gap analysis with actionable fixes for {brand_domain}...
geobrand-mentionssource-preference
Ranking v1.0

Branded Query SERP Feature Plan

Plans which branded SERP features to target and what optimizations unlock each for a brand.

Audit the branded SERP for {brand_name} across its top 20 branded queries. Identify which rich features (sitelinks, Knowledge Panel, FAQ, review stars, social profiles) are present, absent, or suppressed. For each absent feature, prescribe the specific schema, content, or authority action needed to trigger it...
rankingbranded-serprich-results
Technical v1.0

CDN Cache SEO Header Optimizer

Optimizes CDN cache-control headers to balance crawl freshness with server load for SEO.

Review the current CDN cache-control configuration for {site_url} across content types: HTML pages, CSS/JS assets, images, and XML sitemaps. For each content type, recommend Cache-Control, Surrogate-Control, and Vary header values that optimize Googlebot freshness signals without over-purging CDN caches. Output header directives with justification...
technicalcdncaching
GEO v1.0

ChatGPT Source Authority Readiness

Evaluates whether a domain's authority signals meet ChatGPT's implicit source-selection criteria.

Assess {brand_domain} against the authority signals that correlate with ChatGPT citation selection: topical depth, external reference density, author E-E-A-T signals, and structured data coverage. Score each dimension and output a readiness report with the top three highest-impact improvements...
geochatgptsource-authority
GEO v1.0

Citation Context Pre-Publish Audit

Reviews a draft article's citation-worthiness before publication for LLM and AI Overview inclusion.

Review the draft article below intended for {page_url}. Score it on seven citation-readiness criteria: direct answer placement, entity completeness, source authority signals, structured data eligibility, passage retrievability, recency signals, and E-E-A-T markers. Output a score per criterion with targeted revisions...
geocitationpre-publish
Technical v1.0

Cloudflare Worker SEO Rules Spec

Specifies Cloudflare Worker rules to handle SEO-critical redirects, headers, and bot responses at edge.

Write a Cloudflare Worker script for {site_url} that: enforces www-to-non-www (or vice versa) redirects, injects canonical headers for parameterized URLs matching {param_pattern}, returns 410 for the deprecated URL list {dead_url_list}, and passes Googlebot to origin without rate limiting. Include inline comments for each rule block...
technicaledge-seocloudflare
Content v1.0

Content Brief Competitor Angle Map

Builds a content brief by mapping competitor article angles and identifying differentiation opportunities.

Analyze the top 10 ranking pages for '{target_keyword}'. Extract the primary angle, content format, word count, entity coverage, and heading structure of each. Identify the dominant narrative gap no current result addresses. Build a content brief for {site_url} that differentiates on that gap while covering all baseline SERP expectations...
contentbriefcompetitor-analysis
Audit v1.0

Crawl Budget Priority Matrix

Builds a crawl-budget priority matrix showing which URL groups deserve more or less bot attention.

Using the log data and GSC crawl stats for {domain}, segment all URL patterns into groups. Score each group on revenue value, freshness requirement, and current crawl frequency, then output a prioritized matrix with recommended crawl-rate adjustments and noindex/disallow candidates...
auditcrawl-budgetlog-file
Content v1.0

E-E-A-T Author Signal Builder

Audits author bio and byline signals for E-E-A-T compliance and rewrites them to pass QRG standards.

Review the author bio for {author_name} currently displayed on {site_url}. Score it against Google's Quality Rater Guidelines E-E-A-T criteria: verifiable credentials, first-hand experience signals, external authority references, and on-page prominence. Rewrite the bio to maximize E-E-A-T signals within {word_limit} words...
contente-e-a-tauthor
GEO v1.0

Entity Salience Signal Optimizer

Diagnoses entity salience gaps in a page and prescribes markup and copy changes to strengthen them.

Analyze the page content at {page_url} for entity salience signals related to {primary_entity}. Identify where the entity is underrepresented in headings, body copy, and structured data. Output specific copy edits and JSON-LD additions that increase entity salience without keyword stuffing...
geoentitysalience
Content v1.0

FAQ Intent Schema Content Planner

Plans and drafts FAQ blocks aligned to PAA intent clusters with embedded FAQPage schema.

For the topic '{faq_topic}' on {page_url}, extract the 10 most-asked PAA and long-tail questions. Write concise, direct answers (max 60 words each) optimized for featured snippet and AI Overview retrieval. Format the complete output as a FAQPage JSON-LD block ready to embed in the page <head>...
contentfaqschema
GEO v1.0

Generative SERP Source Drift Tracker

Monitors week-over-week changes in which sources appear in generative SERP features for tracked queries.

Compare the generative SERP source snapshots from {date_period_1} and {date_period_2} for the query set {query_list}. Identify domains that entered or exited citation pools, quantify the share-of-voice shift, and hypothesize the content or authority changes that drove each drift event...
geoserp-featuresdrift-tracking
GEO v1.0

GEO Brief Topical Depth Builder

Creates a GEO-optimized content brief focused on topical depth signals that drive LLM citations.

Build a GEO content brief for the topic '{target_topic}' targeting citation in AI Overviews and Perplexity. Include: required entities and their relationship map, subtopics needed for topical completeness, authoritative external sources to reference, and recommended schema types to increase passage retrievability...
geocontent-brieftopical-authority
Audit v1.0

Hreflang Return Tag Gap Auditor

Checks every hreflang pair for missing or incorrect return tags that break international SEO signals.

Parse the hreflang tag export below for {site_url}. For every x-default and locale alternate, verify the reciprocal return tag exists on the target page. List all broken pairs with the missing tag code, the affected URL, and the corrected hreflang attribute to deploy...
audithreflanginternational
Technical v1.0

Hreflang XML Sitemap Locale Architect

Builds a complete hreflang sitemap configuration for multilingual or multi-regional sites.

Build an hreflang XML sitemap for {site_url} covering locales {locale_list}. For each URL set, include reciprocal xhtml:link rel='alternate' entries for every locale variant plus x-default. Flag any locale pairs where the target URL is not yet published. Output the complete sitemap XML and a validation checklist...
technicalhreflangsitemap
Ranking v1.0

Image SERP Alt Text Optimizer

Rewrites image alt text and file names across a page set to improve image SERP visibility.

Review all images on the pages in {page_list} for {site_url}. For each image, evaluate the current alt text, file name, and surrounding copy context. Rewrite alt text and file names to be descriptively accurate, keyword-relevant, and compliant with accessibility standards, then flag any images missing structured data eligibility...
rankingimage-seoalt-text
Audit v1.0

Indexing Exclusion Root Cause

Diagnoses why specific URLs are excluded from Google's index and maps remediation steps.

The following URLs from {site_url} are in the GSC Coverage report as 'Excluded': {url_list}. For each URL, diagnose the most likely root cause (noindex, canonical mismatch, crawl block, thin content, soft 404), and provide a specific remediation action with verification steps.
auditindexinggsc
Technical v1.0

INP Interaction Trace Optimizer

Traces INP bottlenecks to specific interaction events and prescribes code-level optimizations.

Using the INP trace data from {crux_or_lab_tool} for {page_url}, identify the interactions (click, keydown, tap) with the highest input delay, processing time, and presentation delay contributions. For each bottleneck interaction, identify the responsible JS task or layout operation and recommend a specific optimization (code-splitting, debouncing, DOM reduction)...
technicalinpcore-web-vitals
Content v1.0

Internal Link Depth Reduction Plan

Identifies high-value pages buried deep in site architecture and plans link additions to shallow them.

Using the crawl depth report for {site_url}, identify all pages with strategic keyword targeting that sit at crawl depth 4 or greater. For each deep page, recommend three existing pages at depth 1–2 that should link to it, with proposed anchor text, to reduce click depth and improve crawl accessibility...
contentinternal-linkssite-architecture
Ranking v1.0

Knowledge Panel Entity Claim Builder

Identifies missing entity attributes needed to trigger or enrich a Knowledge Panel for a brand.

Audit the current Knowledge Panel state for {brand_name} on Google. List all standard entity attributes (founding date, headquarters, CEO, products, social profiles, description) that are absent or incorrect. For each missing attribute, prescribe the Wikidata edit, schema markup, or authoritative mention needed to surface it...
rankingknowledge-panelentity
Technical v1.0

LCP Resource Load Chain Tracer

Traces the full LCP resource load chain to find render-blocking dependencies delaying paint time.

Analyze the WebPageTest waterfall and Chrome DevTools trace for {page_url}. Identify the LCP element, trace its full resource load chain (render-blocking scripts, stylesheets, font loads, image fetch), and calculate the delay each dependency adds. Output a sequenced fix plan to eliminate chain bottlenecks and achieve LCP under {target_lcp_ms}ms...
technicallcpcore-web-vitals
Ranking v1.0

Local Pack Citation Gap Fixer

Identifies NAP inconsistencies and missing citations blocking a business from the local 3-pack.

Compare the NAP data for {business_name} across Google Business Profile, Bing Places, Yelp, and the top 20 local citation sources. Flag all inconsistencies and missing listings. Output a prioritized fix list ordered by citation authority score, including the exact corrected NAP string to submit to each directory...
rankinglocal-seocitations
Audit v1.0

Mobile First Gap Diagnostic

Compares desktop and mobile-rendered HTML to surface content gaps affecting mobile-first indexing.

Compare the desktop HTML and mobile HTML snapshots below for {page_url}. Identify any content, structured data, internal links, or metadata present on desktop but missing or altered on mobile. Output a gap table and prioritized fixes for mobile-first indexing compliance...
auditmobile-firstrendering
GEO v1.0

Multi-LLM Entity Prominence Test

Tests how prominently a brand entity appears across ChatGPT, Gemini, Perplexity, and Claude responses.

Submit the prompt '{entity_query}' to ChatGPT, Gemini, Perplexity, and Claude. Record whether {brand_name} is mentioned, the position of first mention, and the sentiment context. Produce a cross-LLM prominence table and recommend entity-signal improvements for models where the brand underperforms...
geomulti-llmentity
Ranking v1.0

News SERP Freshness Signal Auditor

Audits content freshness signals on news articles to improve eligibility for Top Stories and news SERP.

Review the article pages in {article_url_list} for {publisher_domain}. Evaluate freshness signals including publication/modified timestamps in markup, date prominence in content, sitemap lastmod values, and crawl frequency patterns. Output a freshness signal scorecard and specific fixes to increase Top Stories eligibility...
rankingnews-seofreshness
Audit v1.0

Orphan Page Link Injection Plan

Identifies orphan pages and prescribes specific internal linking fixes to connect them.

Using the crawl data below for {site_url}, list all URLs with zero internal inlinks. For each orphan page, identify the three most topically relevant pages already indexed that should link to it, and write the exact anchor text and surrounding sentence to use...
auditorphan-pagesinternal-links
Ranking v1.0

People Also Ask Content Gap Map

Mines PAA boxes for a seed topic and maps which questions lack adequate coverage on the target site.

Extract all People Also Ask questions visible for the seed query '{seed_query}' and its top 5 SERP variants. Cross-reference each question against the content inventory for {site_url}. Flag unanswered or weakly answered questions and output a prioritized brief for new FAQ or supporting-page creation...
rankingpaacontent-gap
Content v1.0

Programmatic Content Template Brief

Designs a repeatable programmatic content template for scalable SEO page generation at scale.

Design a programmatic content template for {page_type} pages targeting the keyword pattern '{keyword_pattern}' for {site_url}. Define: required dynamic fields, static copy blocks, entity variables, internal link injection rules, schema type, and minimum unique content threshold per page. Include a sample rendered output for one test entity...
contentprogrammatic-seotemplates
Audit v1.0

Redirect Loop Chain Resolver

Traces multi-hop redirect chains and loops, then outputs a direct-resolution fix plan.

Given the redirect export {redirect_csv} for {domain}, identify all chains longer than two hops and all circular loops. For each, map the full hop sequence, calculate the cumulative link equity loss, and output the single target URL each source should redirect to directly.
auditredirectstechnical
Technical v1.0

Robots.txt Crawl Gate Architect

Designs a robots.txt configuration that gates crawl access by bot type and URL pattern.

Design a robots.txt file for {site_url} that: allows Googlebot full access to {allow_paths}, disallows all bots from {disallow_paths}, rate-limits aggressive third-party scrapers, includes Sitemap directives for {sitemap_urls}, and avoids accidentally blocking CSS/JS required for rendering. Output the complete robots.txt content with inline comments...
technicalrobots-txtcrawl
Technical v1.0

Schema Markup JSON-LD Validator Brief

Validates existing JSON-LD blocks against schema.org spec and Rich Results Test requirements.

Validate the JSON-LD snippets below from {page_url}. For each block, check for: required properties per schema.org spec, deprecated properties, incorrect data types, missing recommended properties for rich result eligibility, and nesting errors. Output a validation report with the corrected JSON-LD for each block...
technicaljson-ldschema
Content v1.0

Schema Rich How-To Content Builder

Drafts a how-to article with embedded HowTo schema steps optimized for rich result eligibility.

Write a complete how-to article for '{how_to_topic}' targeting {target_audience} for {site_url}. Structure content with a direct overview, numbered steps (each ≤80 words), required tools/materials, and expected outcome. Append a complete HowTo JSON-LD block with name, estimatedCost, totalTime, supply, and step arrays filled in...
contenthow-toschema
Ranking v1.0

SERP Volatility Cause Attribution

Attributes ranking volatility spikes to algorithm updates, competitor changes, or on-site factors.

Given the ranking history export for {site_url} covering {date_range}, identify all ranking volatility events (drops or surges of 5+ positions). For each event, cross-reference against known algorithm update dates, competitor content changes, and on-site publish/change logs. Output a cause-attribution table with confidence scores and recommended responses...
rankingvolatilityalgorithm
Ranking v1.0

Shopping Feed SERP Gap Analyzer

Identifies product feed attribute gaps preventing products from appearing in Shopping SERP features.

Analyze the product feed export for {merchant_id} against Google Merchant Center requirements and the Shopping SERP results for the query set {query_list}. Identify missing or low-quality attributes (GTIN, brand, description length, image quality, price accuracy) causing impression loss, and output attribute-by-attribute fix recommendations...
rankingshopping-serpproduct-feed
Content v1.0

Title Tag SERP Intent Rewriter

Rewrites title tags to align with measured SERP click intent and improve CTR for target pages.

Given the current title tags, average CTR, and top ranking keyword for each URL in {page_list}, rewrite each title tag to better match user click intent and SERP expectations. Apply these constraints: under 60 characters, primary keyword near the front, avoid clickbait, maintain brand suffix where applicable. Output old vs. new title comparison table...
contenttitle-tagsctr
Content v1.0

Topic Cluster Spoke Gap Finder

Identifies missing spoke pages in an existing topic cluster that are needed for full topical coverage.

Review the existing content cluster around the pillar page {pillar_url} for {site_url}. Map all current spoke pages and their covered subtopics. Cross-reference against the full subtopic universe for '{pillar_topic}' using PAA, related searches, and competitor coverage. Output a prioritized list of missing spoke pages with title, target keyword, and intent for each...
contenttopic-clustergap-analysis
Ranking v1.0

Video SERP Schema Opportunity Map

Maps video content assets to VideoObject schema opportunities that can unlock video SERP features.

Review the video content inventory for {site_url}. For each video, assess eligibility for VideoObject rich results (duration, thumbnail, description, upload date, transcript availability). Output a schema implementation plan per video with the complete JSON-LD block and any content additions needed to meet eligibility thresholds...
rankingvideo-seoschema
Technical v1.0

XML Sitemap Split Segment Engineer

Designs a segmented XML sitemap index strategy for large sites to improve crawl efficiency.

Design a sitemap index architecture for {site_url} with {total_url_count} URLs. Segment sitemaps by content type ({content_types}), set priority and changefreq values based on publishing cadence, exclude noindex URLs, and define the sitemap index file structure. Output the sitemap index XML and one sample child sitemap per segment...
technicalsitemapcrawl
GEO v1.0

AI Mode Query Cluster Optimizer

Builds a query cluster strategy to maximize {domain} visibility in Google AI Mode answer panels.

For the topic cluster {cluster_topic}, identify the 20 highest-volume queries likely to trigger Google AI Mode answer panels. For each query, analyze the required answer format (definition, comparison, how-to, pros/cons), map which existing {domain} pages partially address them, and produce a content optimization roadmap to improve AI Mode visibility...
geoai-modequery-cluster
GEO v1.0

AI Overview Passage Depth Brief

Builds a passage-depth optimization brief to improve citation likelihood in Google AI Overviews for {topic}.

You are a GEO specialist. For the topic {topic}, analyze what passage-level attributes (depth of explanation, statistic density, direct answer format, entity specificity) correlate with citation in Google AI Overviews. Produce a structured brief with passage rewrite recommendations for {url}...
geoai-overviewpassage-optimization
Ranking v1.0

Branded Query Cannibalization Fix

Detects internal pages cannibalizing {brand} branded queries and recommends canonical or consolidation fixes.

Using the Search Console performance data for {domain}, identify branded query groups (containing '{brand}') where two or more URLs are splitting impressions and clicks. For each cannibalization pair, analyze page intent alignment, consolidation feasibility, and canonical tag options. Output a resolution plan ranked by click recovery potential...
rankingcannibalizationbranded-queries
GEO v1.0

ChatGPT Source Selection Signal Audit

Diagnoses why ChatGPT with Browse selects or skips {domain} as a source for {topic} queries.

Analyze ChatGPT Browse citations for the following {topic}-related queries: {query_list}. For each query, record which domains are cited, what page types are favored, and what structural signals (headers, tables, definitions, author attribution) appear on cited pages. Produce a signal diagnosis and content optimization checklist for {domain}...
geochatgptcitation-signals
Technical v1.0

Cloudflare Worker SEO Redirect Rules

Writes a Cloudflare Worker script implementing SEO-safe bulk redirect rules for {domain} at the edge.

Write a Cloudflare Worker script for {domain} that implements the following bulk redirect rules at the edge: {redirect_rules_list}. The script must: return 301 status codes, preserve URL query strings where specified, set correct Location headers, avoid redirect chains, and include a maintenance mode bypass for Googlebot. Output the complete Worker script with deployment instructions...
technicaledge-seocloudflare-worker
Ranking v1.0

Competitor Gap Cluster Ranker

Identifies keyword clusters where top competitors rank but {domain} has zero visibility.

Compare the ranking keyword sets of {domain} and its top 3 competitors: {competitor_list}. Identify keyword clusters (by topic and intent) where all three competitors rank in positions 1–20 but {domain} has no ranking URL. For each cluster, estimate traffic opportunity size and content investment required. Output a prioritized gap cluster table...
rankingcompetitor-gapkeyword-clusters
Content v1.0

Content Brief SERP Intent Fit

Generates a content brief for {target_keyword} precisely matched to the dominant SERP intent and format.

Analyze the top 10 SERP results for '{target_keyword}'. Identify the dominant content format (guide, listicle, tool, comparison, definition), average word count, heading structure patterns, and featured snippet type. Then produce a full content brief for {domain} that matches this SERP intent signature, including proposed H1, H2 structure, required sections, and word count target...
contentcontent-briefserp-intent
Content v1.0

Content Refresh Traffic Decay Plan

Produces a refresh action plan for pages on {domain} showing 6-month traffic decline patterns.

Analyze the following Search Console performance data showing 6-month traffic trends for {domain}: {gsc_data}. Identify pages with consistent click decline (>20% YoY) that still have meaningful impressions. For each page, diagnose likely decay causes (freshness, competitor displacement, SERP feature insertion) and produce a targeted refresh action plan with specific content changes...
contentcontent-refreshtraffic-decay
Audit v1.0

Duplicate Content Parameter Map

Maps URL parameters that generate duplicate content variants and recommends canonicalization or noindex fixes.

Review the following list of URL parameter combinations found in the crawl of {domain}: {parameter_list}. For each parameter or parameter combination, classify whether it creates duplicate content, near-duplicate content, or unique content. Recommend the appropriate treatment (canonical, noindex, robots disallow, or Google Search Console parameter handling) for each...
auditduplicate-contentparameters
Content v1.0

Content Gap SERP Topic Matrix

Builds a content gap matrix comparing {domain} coverage against SERP-ranking competitors for {topic_area}.

For the topic area '{topic_area}', extract the top 20 ranking URLs across 30 representative queries. Map which sub-topics each URL covers using heading analysis. Compare this sub-topic coverage map against existing {domain} content. Output a gap matrix showing which sub-topics are covered by 3+ competitors but missing from {domain}, sorted by aggregate competitor ranking strength...
contentcontent-gapcompetitor-analysis
GEO v1.0

Entity Salience Prominence Mapper

Maps entity salience scores across {domain} pages to identify where brand entity prominence is weakest.

Analyze the following set of page texts from {domain}: {page_texts}. For each page, identify the top 10 named entities, score their salience (prominence relative to other entities), and flag pages where the brand entity {brand_name} has low salience. Recommend on-page copy changes to increase brand entity prominence...
geoentity-saliencebrand
Audit v1.0

Hreflang Return Tag Gap Checker

Verifies that every hreflang tag in {sitemap_data} has a valid reciprocal return tag.

Analyze the hreflang tag declarations in the following XML sitemap or page source for {domain}: {hreflang_data}. For each locale pair, confirm the return tag exists on the target URL, flag any missing or mismatched return tags, and output an error table grouped by locale with corrected tag snippets...
audithreflanginternational
Ranking v1.0

Image SERP Structured Data Planner

Plans structured data and file optimization changes to improve image SERP visibility for {domain}.

Audit the image assets on {url} for image SERP ranking factors: file naming conventions, alt text specificity, surrounding text relevance, ImageObject schema markup, page load performance, and license metadata. Produce a structured data enhancement plan and image optimization checklist to maximize Google Images visibility...
rankingimage-serpstructured-data
Technical v1.0

JavaScript Render Gap Content Audit

Compares Googlebot-rendered HTML against raw server HTML on {url} to detect JS rendering content gaps.

Compare the following two HTML snapshots of {url}: (1) raw server response HTML and (2) Googlebot-rendered HTML from Google Search Console's URL Inspection tool: {html_comparison_data}. Identify any SEO-critical elements (H1, meta description, canonical, schema markup, internal links, body copy) present in raw HTML but missing or altered post-render. Output a gap table with fix recommendations...
technicaljavascript-renderingcrawl
Technical v1.0

JSON-LD Schema Validation Fixer

Validates a JSON-LD schema block against Google's Rich Results Test rules and outputs a corrected version.

Review the following JSON-LD schema block from {url}: {jsonld_code}. Validate it against Google's Rich Results Test requirements and Schema.org property definitions. Identify all errors (missing required properties, wrong data types, invalid enum values) and warnings. Output the corrected JSON-LD block with inline comments explaining each fix...
technicaljson-ldschema-validation
Ranking v1.0

Knowledge Panel Entity Gap Fixer

Identifies missing entity attributes preventing {brand} from earning or enriching a Google Knowledge Panel.

Audit the current Google Knowledge Panel (or lack thereof) for {brand}. Compare present attributes against the full set of schema.org Organization/Person properties Google uses to populate panels. For each missing attribute, recommend the on-site markup change, Wikidata entry, or third-party mention strategy needed to surface that attribute...
rankingknowledge-panelentity
GEO v1.0

LLM Recency Gap Content Plan

Identifies time-sensitive topics where LLM training cutoffs create citation gaps that {domain} can exploit.

For the niche {niche}, identify topics where LLM training data is likely stale (post-cutoff developments, recent studies, new regulations, updated statistics). For each gap topic, produce a content plan for {domain} that emphasizes freshness signals, publication date markup, and passage structures favored by live-retrieval LLMs like Perplexity...
georecencyllm-citation
Ranking v1.0

Local Pack Citation Signal Brief

Diagnoses NAP citation consistency issues preventing {business} from ranking in the local 3-pack.

Analyze the NAP (Name, Address, Phone) citation profile for {business} across the following directories and data aggregators: {citation_source_list}. Identify all inconsistencies, duplicate listings, and missing citations. Rank fixes by local pack ranking impact and output a remediation plan with exact corrected NAP strings...
rankinglocal-seocitations
Audit v1.0

Log File Segment Opportunity Finder

Identifies crawl opportunity segments from raw server log data for {domain}.

Analyze the following server log extract for {domain} and segment Googlebot activity by URL path prefix, HTTP status code, and crawl frequency. Highlight URL groups that are over-crawled but low-value and under-crawled but high-value, then recommend crawl budget reallocation actions...
auditlog-filecrawl-budget
Audit v1.0

Mobile-First Content Parity Checker

Checks whether mobile-rendered HTML contains equivalent content and structured data to the desktop version.

Compare the following desktop and mobile HTML snapshots for {url}: {desktop_html} vs {mobile_html}. Identify any content blocks, structured data properties, internal links, or canonical signals present on desktop but absent or truncated on mobile. Output a parity gap table with SEO impact ratings...
auditmobile-firstrendering
GEO v1.0

Multi-LLM Answer Gap Brief

Compares how ChatGPT, Claude, Gemini, and Perplexity answer {query} and surfaces content gaps for {domain}.

Submit the query '{query}' to ChatGPT, Claude, Gemini, and Perplexity. Record each model's answer, the sources cited, and the key claims made. Identify claims or sub-topics that appear in multiple LLM answers but are absent or thin on {domain}. Output a gap matrix and content brief...
geomulti-llmcontent-gap
Technical v1.0

Prerender Eligibility Route Spec

Identifies which {domain} URL routes are eligible for prerendering and outputs a prerender configuration spec.

Analyze the JavaScript framework architecture and URL route patterns of {domain}: {route_config}. For each route, assess prerender eligibility based on: static vs. dynamic content ratio, user-specific data requirements, cache invalidation complexity, and Googlebot compatibility. Output a prerender configuration file specifying which routes should be prerendered, with TTL and cache-busting logic...
technicalprerenderingrendering
Audit v1.0

Redirect Chain Impact Scorer

Scores redirect chains by PageRank dilution risk and crawl waste for {domain}.

Analyze the following redirect chain map for {domain}: {redirect_chain_data}. For each chain longer than one hop, calculate the cumulative PageRank dilution risk, crawl cost, and user latency impact. Output a severity-ranked table with collapse recommendations and the target canonical URL for each chain...
auditredirectspagerank
Technical v1.0

Robots.txt Crawl Scope Optimizer

Rewrites {domain}'s robots.txt to protect crawl budget and unblock accidentally disallowed priority URLs.

Analyze the current robots.txt for {domain}: {robots_txt_content}. Cross-reference disallowed paths against the list of high-priority URLs from Search Console. Identify any accidentally blocked important pages and any missing disallow rules for faceted nav, session parameters, or staging paths. Output a rewritten robots.txt with inline rationale comments...
technicalrobots-txtcrawl-budget
Ranking v1.0

Video SERP Schema Opportunity Plan

Identifies video content on {domain} lacking VideoObject schema and maps it to high-volume query targets.

Review all video assets hosted or embedded on {domain}. For each video, check for VideoObject schema markup completeness (name, description, thumbnailUrl, uploadDate, duration, contentUrl). Map each video to target queries with video SERP features present in the top 10. Output a prioritized schema implementation plan...
rankingvideo-serpschema
Technical v1.0

Sitemap Index Health Architect

Redesigns {domain}'s sitemap index structure to maximize crawl efficiency and indexing signal quality.

Review the current sitemap index structure for {domain}: {sitemap_structure}. Identify issues including: sitemaps exceeding 50,000 URL limits, inclusion of noindex or redirected URLs, missing lastmod dates, incorrect priority values, and absence of image or video sitemaps. Output a restructured sitemap index specification with file segmentation logic...
technicalsitemapcrawl-efficiency
GEO v1.0

AI Mode Cluster Coverage Planner

Plans content cluster coverage needed to appear in Google AI Mode for a topic.

Analyze the subtopics covered in Google AI Mode responses for '{core_topic}'. Map each subtopic against existing content on {our_domain}. Identify coverage gaps, recommend new pages or section expansions, and sequence them by estimated AI Mode visibility impact...
geoai-modecluster
GEO v1.0

AI Overview Passage Depth Gap

Identifies content depth gaps preventing a page from being pulled into AI Overview passages.

For the query '{target_query}', review the AI Overview passage currently shown and compare it against the content on {url}. Identify specific sentences, statistics, or definitions missing from our page that appear in the AI Overview, and rewrite those sections to improve passage eligibility...
geoai-overviewcontent
GEO v1.0

Brand Mention Context Gap Map

Maps the topical contexts in which a brand is and isn't mentioned across LLM outputs.

Run the following prompts across ChatGPT and Perplexity: {prompt_list}. Record every mention of {brand} and its surrounding context. Identify topic contexts where {brand} is systematically absent and recommend content or entity-building tactics for each gap...
geobrand-mentionentity
Audit v1.0

Canonical Chain Loop Detector

Finds canonical tag chains and loops that dilute link equity and confuse Googlebot.

Using the canonical tag data below for {site}, trace every canonical chain to its terminal URL. Flag any chains longer than two hops, circular references, and canonicals pointing to non-indexable pages. Output a corrected canonical map...
auditcanonicaltechnical
GEO v1.0

ChatGPT Entity Citation Gap

Finds entity associations missing from ChatGPT responses that prevent brand citation.

Query ChatGPT with '{test_prompt}' and record the response. Identify every entity, brand, product, or statistic cited. Compare against {our_brand}'s known entity associations and flag gaps that explain why we are not cited. Recommend content or PR actions to close each gap...
geochatgptentity
Ranking v1.0

Competitor SERP Share Gap Audit

Measures SERP real-estate share gap between a site and its top competitor across a keyword set.

Using ranking data for {keyword_set}, calculate the share of top-10 SERP positions held by {our_domain} vs. {competitor_domain}. Identify keyword segments where the competitor leads by the largest margin, diagnose ranking gap causes, and recommend a prioritized attack plan...
rankingcompetitor-gapserp
Content v1.0

Content Gap SERP Entity Finder

Finds entities covered by top-ranking competitors but absent from our content.

Extract all named entities (people, organizations, concepts, statistics) from the top 5 ranking pages for '{target_keyword}'. Compare against entity coverage in our page at {url}. List missing entities by frequency of appearance in competitor content and recommend integration points...
contententitygap-analysis
Content v1.0

Content Refresh Decay Ranker

Ranks decaying content pages by recovery potential to prioritize the refresh queue.

Using the traffic and ranking trend data below for {site}, identify pages with consistent month-over-month traffic decline over {period}. Score each page on recovery potential (current rank position, backlink count, keyword volume) and output a ranked refresh priority list with recommended update actions...
contentrefreshdecay
Audit v1.0

CrUX Gap Vitals Audit

Compares CrUX field data against lab data to expose real-user Core Web Vitals gaps.

Compare the CrUX field data and lab (Lighthouse) data provided below for {site}. Identify metrics where field and lab scores diverge by more than {threshold}%, diagnose likely causes (third-party scripts, font loading, layout shifts), and list remediation steps...
auditcore-web-vitalscrux
Audit v1.0

Crawl Budget Priority Segmenter

Segments a site's URLs by crawl priority to help allocate Googlebot budget efficiently.

Using the URL inventory and crawl frequency data below for {site}, segment all URLs into High, Medium, and Low crawl priority tiers. Recommend robots.txt or crawl-rate adjustments to concentrate budget on high-value pages...
auditcrawl-budgettechnical
Content v1.0

E-E-A-T Author Trust Signal Builder

Builds an author trust signal profile to strengthen E-E-A-T for YMYL content pages.

Review the author bio, credential signals, and on-page attribution for {author_name} on {site}. Score current E-E-A-T trust signals across Experience, Expertise, Authoritativeness, and Trustworthiness. Identify gaps and write enhanced author bio copy, schema markup, and off-page credibility recommendations...
contente-e-a-tauthor
Technical v1.0

Edge SEO Header Injection Spec

Specifies Cloudflare Worker logic to inject or rewrite HTTP response headers for SEO.

Write a Cloudflare Worker script for {site} that intercepts HTML responses and injects the following HTTP headers: {header_list}. Include conditional logic to apply different header sets to {page_type_a} vs. {page_type_b}. Add inline comments explaining the SEO rationale for each rule...
technicaledge-seocloudflare
Audit v1.0

Faceted Nav Parameter Audit

Evaluates URL parameters created by faceted navigation for crawl waste and indexing risk.

Review the faceted navigation parameter list and crawl log data for {site}. Identify which parameter combinations produce near-duplicate or low-value pages, estimate crawl waste, and recommend robots.txt disallow rules or canonical strategies for each...
auditfaceted-navcrawl-budget
Ranking v1.0

Featured Snippet Format Type Audit

Audits target keywords to determine which featured snippet format each query demands.

For each keyword in {keyword_list}, identify the current featured snippet format (paragraph, list, table, video, none). Map our existing content format against the required format, flag mismatches, and produce a reformatting brief for each mismatched URL...
rankingfeatured-snippetformat
GEO v1.0

Generative SERP Content Fit Scorer

Scores how well existing content matches generative SERP feature formats and requirements.

Evaluate the content at {url} against the generative SERP features appearing for '{target_query}' (AI Overview, conversational snippet, cited source). Score each dimension: passage clarity, entity density, direct answer presence, and citation-readiness. Output a rewrite priority list...
geogenerative-serpcontent-fit
GEO v1.0

GEO Entity Prominence Audit

Audits how prominently a brand entity appears in LLM-generated answers for key queries.

For each query in {query_list}, capture the full LLM response from ChatGPT and Perplexity. Score {brand} on mention position (first, middle, last), surrounding sentiment, and co-cited entities. Produce a prominence score and entity reinforcement recommendations...
geoentityprominence
Audit v1.0

Hreflang Return Tag Gap

Detects missing hreflang return tags that break bidirectional locale signal integrity.

Analyze the hreflang tag data below for {site}. For each locale pair, verify that a valid return tag exists on the target URL. List every missing or mismatched return tag, the affected locales, and the corrected tag values needed...
audithreflanginternational
Technical v1.0

INP Interaction Event Root Fix

Diagnoses the root cause of a slow INP event and prescribes targeted JavaScript fixes.

Using the Chrome DevTools performance trace and INP attribution data for {url}, identify the interaction event causing the worst INP score. Break down processing time into input delay, processing time, and presentation delay. Recommend specific JS optimizations (event handler debouncing, task splitting, script deferral) to bring INP below 200ms...
technicalinpperformance
Technical v1.0

JSON-LD Breadcrumb Schema Generator

Generates valid BreadcrumbList JSON-LD markup for a given URL hierarchy.

Generate valid BreadcrumbList JSON-LD schema markup for the following URL hierarchy on {site}: {url_hierarchy}. Follow Google's structured data guidelines, include all ListItem positions and URLs, and output the complete script tag ready for insertion into the page <head>...
technicalschemajson-ld
Technical v1.0

Hreflang Sitemap Locale Spec

Generates a complete hreflang XML sitemap configuration for a multi-locale site.

Generate a complete XML sitemap with hreflang annotations for {site} covering the following locale and URL combinations: {locale_url_map}. Follow Google's sitemap hreflang specification, include x-default entries, and validate that all return tag pairs are present...
technicalhreflangsitemap
Content v1.0

Internal Link Depth Distribution Plan

Plans internal link additions to reduce click depth for high-value but buried pages.

Using crawl depth data for {site}, identify all high-priority pages (based on {priority_signal}) sitting deeper than {max_depth} clicks from the homepage. For each, recommend specific pages and anchor text for new internal links that would reduce their click depth...
contentinternal-linksdepth
GEO v1.0

LLM Recency Freshness Plan

Builds a content freshness plan to exploit LLM recency bias in citation selection.

Analyze the publication and update dates of sources cited by LLMs for '{topic}'. Identify the recency threshold at which sources are preferred. Produce a refresh schedule for {our_domain} pages so they meet or exceed that recency threshold for each subtopic...
georecencyfreshness
Ranking v1.0

News SERP Freshness Eligibility Audit

Audits a publisher's technical and content signals needed for Google News SERP inclusion.

Evaluate {site} against Google News SERP eligibility requirements: publication date markup, article schema, author bylines, URL structure, site speed, and content freshness cadence. Score each factor, identify failures, and produce a remediation checklist...
rankingnews-serpfreshness
Ranking v1.0

Local Pack Citation Gap Finder

Compares local citation profiles of pack leaders against a target business to find NAP gaps.

Compare the local citation profiles of the top 3 Google Local Pack results for '{query}' in {location} against {our_business}. List directories where competitors have citations but we do not, NAP inconsistencies, and an acquisition priority list sorted by domain authority...
rankinglocal-packcitations
Audit v1.0

Mobile Rendering Delta Audit

Compares desktop vs. mobile-rendered HTML to surface content or link parity issues.

Compare the desktop-rendered and mobile-rendered HTML snapshots below for {url}. Identify any content blocks, navigation links, structured data, or meta tags present on desktop but absent on mobile. Prioritize findings by SEO impact...
auditmobile-firstrendering
Audit v1.0

Orphan Page Link Gap Report

Surfaces pages with no internal links pointing to them and recommends linking opportunities.

Using the crawl data below for {site}, identify all pages receiving zero internal links. Group orphans by page type, estimate traffic impact, and recommend the three best internal linking opportunities for each...
auditinternal-linksorphan
Ranking v1.0

PAA Question Intent Clusterer

Groups People Also Ask questions by intent type to reveal FAQ and content structure gaps.

Collect People Also Ask questions for '{seed_keyword}' across {serp_depth} pages. Cluster questions by intent type (informational, navigational, commercial, transactional). Identify intent clusters not covered by existing content on {our_domain} and recommend page sections to add...
rankingpaaintent
GEO v1.0

Perplexity Source Authority Scorer

Scores a domain's authority signals relative to sources Perplexity cites for target queries.

For the topic '{topic}', retrieve the top sources Perplexity currently cites. Score each source across domain authority, topical depth, recency, and citation frequency. Then score {our_domain} on the same dimensions and produce a gap-closing action plan...
geoperplexityauthority
Technical v1.0

Prerender Bot Eligibility Config

Configures prerendering rules to serve static HTML to bots without triggering cloaking flags.

Design a prerendering configuration for {site} using {prerender_service}. Define bot user-agent detection logic, URL inclusion/exclusion rules, cache refresh intervals, and header passthrough requirements. Include a cloaking risk checklist to ensure rendered content served to bots matches user-facing content...
technicalprerenderrendering
Content v1.0

Programmatic Content Schema Seed Plan

Designs a schema-enriched template and data seed strategy for programmatic page generation.

Design a programmatic content template for the '{page_type}' page type on {site}. Define the dynamic content slots, static copy framework, target schema markup types (e.g., LocalBusiness, Product, FAQPage), and the data fields needed from {data_source} to populate each slot at scale...
contentprogrammaticschema
Technical v1.0

SSR SEO Configuration Spec

Produces a server-side rendering configuration spec optimized for Googlebot content delivery.

Design an SSR configuration for {framework} on {site} that ensures Googlebot receives fully rendered HTML including: dynamic meta tags, JSON-LD schema, canonical tags, and hreflang attributes. Specify hydration strategy, caching rules, and bot-detection logic to avoid cloaking...
technicalssrrendering
Ranking v1.0

Shopping SERP Feed Attribute Audit

Audits Google Shopping feed attributes against top-ranking competitor listings.

Compare our Google Merchant Center feed attributes for product category '{category}' against the top 5 Shopping SERP results. Identify missing or weak attributes (title keywords, GTINs, condition, color, size), and produce a feed optimization action plan ranked by impact...
rankingshopping-serpfeed
GEO v1.0

Source Authority Drift Monitor

Tracks month-over-month shifts in which sources LLMs prefer for a topic cluster.

Compare LLM citation source data for '{topic_cluster}' from {month_1} and {month_2}. Identify sources that gained or lost citation frequency, calculate drift scores, and flag whether {our_domain} moved up or down. Recommend actions to reverse negative drift...
geodriftmonitoring
Audit v1.0

Log File Anomaly Finder

Identifies crawl anomalies and bot behavior patterns inside raw server log files.

Analyze the following server log file data for {site}: identify unusual bot behavior, crawl spikes, ignored URLs, and pages receiving zero Googlebot hits. Summarize anomalies in a prioritized table...
auditlog-filecrawl
Content v1.0

Title Meta CTR Rewriter

Rewrites underperforming title tags and meta descriptions to improve SERP click-through rate.

Review the GSC CTR data for the URLs below. For any page with CTR below {ctr_threshold}% at average position {position} or better, rewrite the title tag and meta description. Incorporate the primary keyword, a clear value proposition, and a CTA. Output in a before/after table...
contentctrmeta
Content v1.0

Topic Cluster Hub-Spoke Mapper

Maps hub and spoke pages for a topic cluster and identifies missing spoke content.

Given the core topic '{pillar_topic}' and the existing content inventory for {our_domain}, map the full hub-and-spoke cluster structure. Identify missing spoke topics, suggest titles and target keywords for each gap page, and recommend internal link architecture...
contentclusterhub-spoke
Technical v1.0

XML Sitemap Health Priority Audit

Audits XML sitemap entries for accuracy, coverage gaps, and incorrect priority/changefreq values.

Audit the XML sitemap(s) for {site}. Identify URLs in the sitemap that are non-canonical, redirect, return non-200 status, or are blocked by robots.txt. Also flag pages missing from the sitemap that should be included. Output findings in a categorized issue table with fix instructions...
technicalsitemapindexing
GEO v1.0

AI Mode Query Cluster Plan

Maps a topic's query clusters to AI Mode answer formats and recommends content optimizations.

You are a GEO strategist specializing in AI Mode. For the topic {topic}, identify the 15 most likely AI Mode query clusters, describe the expected answer format for each (list, comparison, how-to, etc.), and recommend specific content changes on {domain} to maximize appearance in AI Mode responses...
geoai-modequery-clusters
GEO v1.0

AI Overview Passage Scoring

Scores existing page passages for AI Overview retrieval likelihood based on structure and entity clarity.

Act as a GEO specialist. Review the following page content from {url} and score each passage (1–10) for AI Overview retrieval likelihood, citing structure, entity clarity, factual density, and citation-readiness. Suggest rewrites for the lowest-scoring passages: {page_content}...
geoai-overviewpassages
GEO v1.0

Brand Mention Gap Audit

Identifies high-authority pages discussing target topics where the brand is unmentioned and should be cited.

Act as a digital PR and GEO strategist. Using the following list of high-authority pages ranking for {target_topic}, identify every page that discusses the topic without mentioning {brand}, and draft a prioritized outreach plan to earn brand mentions on the top 10...
geobrand-mentionsoutreach
Ranking v1.0

Branded Query SERP Gap Fixer

Audits branded SERP results and identifies gaps in brand-controlled results and reputation signals.

You are a branded SERP strategist. For the brand name '{brand}', analyze the current top 20 SERP results and identify: results not controlled by {brand}, negative sentiment pages in top 10, missing rich results, and Knowledge Panel gaps. Produce a 60-day plan to improve branded SERP ownership...
rankingbranded-serpreputation
Audit v1.0

Canonical Audit Conflict Mapper

Maps canonical tag conflicts including self-referencing issues, chains, and cross-domain misuse.

Act as a technical SEO auditor. Analyze the following canonical tag data for {domain} and map every conflict type: canonicalized-to-redirect, cross-domain canonicals, canonicalized pages receiving internal links, and canonical chains longer than one hop: {canonical_data}...
auditcanonicalindexing
Technical v1.0

CDN Cache SEO Header Builder

Configures CDN cache-control headers to maximize crawl freshness without over-purging cached pages.

Act as a CDN and SEO performance engineer. Design the Cache-Control, Surrogate-Control, and Vary header configuration for {domain} hosted on {cdn_provider}. Optimize TTL settings by page type (homepage, category, article, product), ensure Googlebot receives fresh content within {freshness_window}, and document edge cache purge triggers...
technicalcdncaching
GEO v1.0

ChatGPT Source Citation Readiness

Evaluates whether a page's content structure meets ChatGPT's apparent citation selection criteria.

Act as a generative engine optimization expert. Analyze the following content from {url} and assess its readiness to be cited by ChatGPT when answering questions about {topic}. Score on: factual specificity, sourcing signals, entity coverage, and prose clarity. Suggest improvements...
geochatgptcitations
Ranking v1.0

Competitor Ranking Gap Mapper

Maps keywords where top competitors rank in positions 1–10 but the target domain is absent or below 20.

You are an SEO competitive analyst. Given the ranking data below for {domain} and its top 3 competitors ({competitor_list}), identify all keywords where competitors hold positions 1–10 and {domain} ranks below 20 or not at all. Prioritize gaps by estimated traffic opportunity and content feasibility: {ranking_data}...
rankingcompetitor-gapkeywords
Content v1.0

Content Gap SERP Cluster Finder

Finds content gaps by comparing competitor page clusters to a site's existing content inventory.

Act as a content gap analyst. Compare the following content inventory of {domain} against the top 5 competitor content clusters for {topic}. Identify subtopics, question clusters, and use-case pages that competitors cover but {domain} is missing entirely. Rank gaps by estimated traffic opportunity: {content_inventory}...
contentcontent-gapcompetitor
Audit v1.0

Core Web Vitals CrUX Diagnosis

Diagnoses CrUX field data failures for LCP, INP, and CLS and maps them to root causes.

Act as a Core Web Vitals engineer. Using the CrUX field data below for {domain}, identify which page groups are failing LCP, INP, or CLS thresholds, hypothesize root causes for each, and recommend a sequenced remediation plan: {crux_data}...
auditcore-web-vitalsperformance
Audit v1.0

Crawl Budget Priority Audit

Reviews crawl budget allocation and identifies low-value URL types wasting Googlebot crawl.

You are a crawl budget optimization expert. Using the crawl data below for {domain}, identify URL patterns consuming crawl budget without delivering indexing value, and produce a robots.txt + canonical strategy to reclaim budget for high-value pages: {crawl_data}...
auditcrawl-budgetindexing
Content v1.0

FAQ Entity Schema Content Plan

Generates FAQ content blocks with embedded entity signals and FAQPage schema markup ready to publish.

Act as a structured content writer. For the topic '{topic}' on {domain}, generate 12 FAQ pairs optimized for featured snippets and AI Overviews. Each answer should be 40–60 words, entity-rich, and factually precise. Append the full FAQPage JSON-LD schema block for all 12 pairs...
contentfaqschema
Ranking v1.0

Featured Snippet Format Win Brief

Identifies which featured snippet format a query rewards and drafts the optimal content block to win it.

You are a featured snippet optimization specialist. For the query '{target_query}', analyze the current snippet format (paragraph, list, table, video), identify the exact content structure needed to displace the current winner, and draft a replacement snippet block for {domain} to test...
rankingfeatured-snippetserp
Audit v1.0

Hreflang Return Tag Auditor

Checks hreflang tag implementations for missing return tags and locale mismatches across pages.

You are an international SEO specialist. Review the following hreflang tag export for {domain} and identify: missing return tags, incorrect locale codes, self-referencing omissions, and x-default conflicts. Output findings as a prioritized fix table: {hreflang_export}...
audithreflanginternational
Ranking v1.0

Image SERP Opportunity Planner

Finds keyword clusters where image SERP results dominate and plans optimized image content to rank.

Act as a visual SEO strategist. For the keyword set {keyword_set} in the {niche} niche, identify queries where Google Image results appear in the main SERP, analyze the image types and alt text patterns of current winners, and produce an image content plan for {domain} to capture image SERP visibility...
rankingimage-serpvisual-seo
Content v1.0

Internal Link Anchor Diversity Plan

Audits anchor text distribution for internal links to a target page and plans a diversification strategy.

Act as an internal linking strategist. Analyze the current internal link anchor text distribution pointing to '{target_url}' on {domain}. Identify over-optimized, under-optimized, or missing anchor variants and produce a diversified anchor text plan with recommended source pages for each new anchor variant: {anchor_data}...
contentinternal-linksanchor-text
Technical v1.0

JSON-LD Organization Schema Spec

Generates a complete, validated Organization JSON-LD schema block for a brand's homepage.

Act as a structured data engineer. Generate a complete, Google-compliant Organization JSON-LD schema block for {brand} to be placed on {domain}'s homepage. Include: legalName, url, logo, sameAs (with all social profiles), contactPoint, address, and foundingDate. Validate against schema.org spec and flag any required vs recommended properties...
technicalschemajson-ld
GEO v1.0

Generative SERP Citation Context Plan

Plans citation context improvements so pages are quoted accurately in generative SERP features.

Act as a GEO content strategist. Review the following pages from {domain} that target {topic} and identify the specific sentences or passages most likely to be extracted as citations in AI-generated answers. Rewrite each to improve factual precision, quotability, and attribution clarity...
geocitationsgenerative-serp
Ranking v1.0

Knowledge Panel Attribute Builder

Identifies missing knowledge panel attributes for a brand entity and recommends structured data fixes.

You are a Knowledge Graph optimization specialist. Audit the current Knowledge Panel for {brand} and identify every missing or incorrect attribute (founded date, industry, CEO, headquarters, etc.). For each gap, recommend the specific schema markup, Wikipedia edit, or Wikidata entry needed to correct it...
rankingknowledge-panelentity
GEO v1.0

LLM Entity Association Audit

Audits how strongly LLMs associate a brand entity with target topics, attributes, and competitor entities.

Act as a GEO entity analyst. Query multiple LLMs with prompts about {brand} and its core topic of {topic}. Measure entity association strength, identify incorrect or missing attribute associations, and recommend content and off-site actions to reinforce the desired entity model...
geoentitybrand
Audit v1.0

Log File Segment Analysis

Analyzes server log file segments to surface crawl patterns and Googlebot behavior anomalies.

You are an SEO log file analyst. Given the following server log excerpt for {domain}, identify Googlebot crawl frequency by URL segment, detect crawl anomalies, and flag any high-value pages being under-crawled: {log_excerpt}...
auditlog-filecrawl
GEO v1.0

LLM Recency Content Freshness Plan

Identifies content pages losing LLM citation share due to staleness and plans freshness updates.

You are a GEO freshness analyst. For the following content pages on {domain} covering {topic}, assess which pages are losing LLM citation share due to outdated statistics, superseded recommendations, or missing recent developments. Produce a refresh priority list with specific update actions...
geofreshnesscontent-refresh
Audit v1.0

Orphan Page Recovery Audit

Identifies orphan pages with no internal links and recommends link-equity recovery actions.

You are a technical SEO consultant. Given the following crawl export for {domain}, identify all URLs that receive zero internal links, estimate their organic traffic potential using {traffic_data}, and recommend the top 20 highest-priority pages to rescue with internal links...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Question Intent Deep Dive

Mines People Also Ask questions for a seed keyword and maps each to an intent type and content gap.

Act as an SEO content strategist. For the seed keyword '{seed_keyword}', extract the full PAA tree (minimum 30 questions), classify each by intent type and funnel stage, and map them to existing or missing pages on {domain}. Highlight the top 10 highest-priority content gaps...
rankingpaacontent-gaps
GEO v1.0

Perplexity Citation Competitor Analysis

Compares which competitor domains Perplexity cites for target queries and surfaces citation gaps.

You are a GEO analyst. For the following list of queries in {niche}, document which domains Perplexity AI cites in its answers, calculate citation share by domain, and identify gaps where {brand} is absent despite having strong content: {query_list}...
geoperplexitycitations
Audit v1.0

Redirect Chain Severity Scorer

Scores redirect chains by depth and link equity loss to prioritize consolidation work.

Act as an SEO engineer. Analyze the following redirect chain data for {domain} and score each chain by severity (depth, PageRank dilution risk, and user experience impact). Output a ranked table with recommended actions: {redirect_chain_data}...
auditredirectscrawl
Audit v1.0

Schema Markup Audit Report

Audits existing schema markup across a site's page types and surfaces missing or broken implementations.

Act as a structured data specialist. Review the following list of page types and their current schema implementations for {domain} and identify gaps, invalid properties, or missing schema types that would improve rich-result eligibility: {page_type_schema_list}...
auditschemarich-results
Content v1.0

Schema-Rich How-To Content Block

Drafts a HowTo-schema-ready content section with step-by-step structure optimized for rich results.

You are a structured content specialist. Write a HowTo content block for '{task}' targeted at {domain}'s audience. Include 6–10 clearly numbered steps, each with a step name, description, and optional tool/supply. Append valid HowToStep JSON-LD schema markup for the full procedure...
contenthow-toschema
Ranking v1.0

SERP Intent Classification Audit

Classifies the dominant intent type for a keyword list and flags pages misaligned with SERP intent.

Act as an SEO strategist. For the following keyword list for {domain}, classify each keyword's dominant SERP intent (informational, navigational, commercial, transactional) by analyzing the current top 10 results, then flag which existing pages are misaligned with their target intent and recommend remediation: {keyword_list}...
rankingintentserp
Content v1.0

Topic Cluster Hub-Spoke Brief

Creates a full hub-and-spoke content plan including pillar page scope and spoke article briefs.

You are a content architecture strategist. Design a complete hub-and-spoke topic cluster for '{pillar_topic}' on {domain}. Define the pillar page scope and structure, list 15–20 spoke articles with their target keywords and intent types, and map the internal linking flow between hub and spokes...
contenttopic-clusterarchitecture
Ranking v1.0

Topic Cluster Opportunity Sizer

Estimates organic traffic opportunity for an unbuilt topic cluster using search volume and difficulty data.

Act as an SEO strategist. For the proposed topic cluster around '{pillar_topic}' for {domain}, calculate total addressable search volume across all cluster keywords, weight by average CTR curve at realistic rank positions, and produce a 12-month traffic forecast with a confidence interval based on current domain authority: {cluster_keywords}...
rankingtopic-clusteropportunity
Technical v1.0

XML Sitemap Split Strategy

Designs an optimized sitemap index split strategy for large sites exceeding 50,000 URLs.

Act as a technical SEO architect. Design a sitemap index architecture for {domain} which has {url_count} indexable URLs across {page_types}. Define how to split sitemaps by page type and priority tier, set lastmod and changefreq values correctly, and produce the XML sitemap index template...
technicalsitemapcrawl
GEO v1.0

ChatGPT Entity Citation Readiness Check

Assesses whether a brand's entity signals are strong enough for ChatGPT to cite it.

Evaluate {brand}'s entity readiness for ChatGPT citation across these dimensions: Wikipedia presence, Wikidata entry, third-party mentions, schema Organization markup, and consistent NAP. Score each dimension and output a prioritized action plan...
geochatgptentity
Content v1.0

Content Outline Competitor Gap Builder

Structures a content outline that covers subtopics competitors rank for but the target page misses.

Analyze the top-ranking articles for {keyword} and extract subtopics covered by at least 3 competitors but absent from {target_url}. Build a revised content outline with new H2/H3 sections for each gap topic, including recommended depth and supporting sources...
contentoutlinegap
Content v1.0

FAQ Schema Intent Block Generator

Generates intent-matched FAQ blocks with FAQPage schema ready for implementation.

For the topic {topic}, generate 8–10 frequently asked questions matched to informational and commercial intent queries. For each Q&A pair, write a concise, factually grounded answer (max 300 chars) and output the complete FAQPage JSON-LD block ready for implementation...
contentfaqschema
Audit v1.0

Hreflang Return Tag Matrix Checker

Validates that every hreflang annotation has a reciprocal return tag across all locales.

Given the hreflang tag export for {domain}, build a locale-URL matrix and flag every instance where a page references an alternate locale without a corresponding return tag pointing back. Output a correction file in XML sitemap format...
audithreflanginternational
Technical v1.0

INP Interaction Trace Fix Spec

Diagnoses high INP scores by tracing slow interaction events and prescribing JS fixes.

Using the Chrome DevTools Performance trace for {url}, identify the top-3 interactions with the highest Input Delay + Processing Time + Presentation Delay. For each, trace the responsible JS event handlers, identify long tasks blocking the main thread, and output a specific code-level fix recommendation...
technicalinpperformance
Audit v1.0

Internal Link Depth Distribution Mapper

Visualizes how PageRank flows across crawl depths via internal link structure.

Using the internal link graph export for {domain}, calculate the in-link count, average click depth, and estimated PageRank tier for each URL. Highlight pages with high organic value but low internal link equity and recommend link redistribution...
auditinternal-linkspagerank
Ranking v1.0

Knowledge Panel Entity Signal Gap

Identifies missing entity signals preventing or weakening a brand's Knowledge Panel.

Audit the entity signals for {brand} across Google's Knowledge Graph inputs: Wikidata, Wikipedia, Google Business Profile, schema Organization markup, and authoritative third-party mentions. Score each signal source and output a step-by-step remediation plan to trigger or strengthen a Knowledge Panel...
rankingknowledge-panelentity
GEO v1.0

LLM Recency Signal Content Gap

Identifies content topics where LLMs may deprioritize a brand due to stale publish dates.

Review the publication dates of {domain}'s top-cited pages and compare them against competitor content freshness for {topic_list}. Flag pages where freshness lag may reduce LLM citation preference and recommend a refresh schedule with specific update types...
georecencyfreshness
Ranking v1.0

Local Pack Proximity Gap Audit

Audits local pack visibility gaps across geographic radius segments for a target business.

Using rank tracking data for {business_name} in {location}, segment local pack visibility by proximity radius (0.5 km, 1 km, 3 km, 5 km). Identify radius bands where pack position drops and output a citation, GBP, and content strategy to recover local visibility...
rankinglocal-packlocal-seo
Audit v1.0

Log File Crawl Waste Finder

Pinpoints Googlebot time wasted on low-value URLs using raw server log data.

Given the server log excerpt for {domain}, segment Googlebot requests by URL pattern, identify URL groups consuming >10% of crawl budget with zero organic traffic, and output a prioritized list of disallow or noindex recommendations with estimated crawl savings...
auditlog-filecrawl-budget
Audit v1.0

Mobile-First Indexing Gap Audit

Compares desktop and mobile-rendered content to surface mobile-first indexing gaps.

Compare the desktop and mobile-rendered HTML snapshots for {url_list}. Flag any instances where primary content, structured data, or canonical tags differ between versions, and prioritize fixes by indexing risk...
auditmobile-firstrendering
Ranking v1.0

News SERP Freshness Eligibility Plan

Builds a publishing cadence and technical plan to improve News SERP freshness eligibility.

Audit {domain}'s current News SERP eligibility: publication timestamps, NewsArticle schema, news sitemap freshness, and crawl frequency signals. Output a technical and editorial plan to meet Google News freshness standards and maximize Top Stories inclusion...
rankingnews-serpfreshness
Audit v1.0

Orphan Page Link Gap Audit

Surfaces indexable pages with zero internal links and prescribes link insertion points.

Using the crawl data for {domain}, identify all indexable URLs with no internal inlinks. For each orphan, suggest three contextually relevant source pages and anchor text to restore crawlability and PageRank flow...
auditinternal-linksorphan
Ranking v1.0

People Also Ask Intent Gap Miner

Mines PAA questions for a topic to find content gaps and quick-win answer opportunities.

Extract all People Also Ask questions triggered by {seed_keyword} across the top 20 SERPs. Cluster questions by intent sub-type, identify which {domain} pages (if any) currently answer each, and output a gap list with recommended content formats for each unanswered PAA...
rankingpaacontent-gap
GEO v1.0

Perplexity Citation Competitor Profile

Identifies which competitor domains Perplexity cites most for a target topic set.

Run the following {query_list} in Perplexity and record every cited source. Build a domain-level citation frequency table, identify the content types and formats most cited, and output a gap analysis showing where {brand} is absent but competitors rank...
geoperplexitycitation
Content v1.0

Programmatic Content Page Seeder

Creates a scalable content template and variable map for programmatic SEO page generation.

Design a programmatic content template for {page_type} pages on {domain}. Define the page structure, dynamic variable slots (e.g., {city}, {service}), static editorial components, required schema type, and uniqueness strategy to ensure each generated page passes thin-content quality checks...
contentprogrammatictemplate
Audit v1.0

Redirect Chain Target Consolidation

Maps multi-hop redirect chains and outputs a direct 301 consolidation plan.

Analyze the redirect list exported from {domain}. Identify all chains of 2+ hops, calculate cumulative redirect latency, and output a consolidation table mapping each chain origin directly to its final destination URL with HTTP status codes...
auditredirectstechnical
Audit v1.0

Schema Type Gap Auditor

Compares deployed schema types against eligible rich-result types for each page template.

Review the schema markup inventory for {domain} and map each page template (e.g., product, article, FAQ) against all eligible schema types per Google's Rich Results documentation. Output a gap table showing missing types, implementation priority, and expected rich-result benefit...
auditschemarich-results
Audit v1.0

Technical Site Crawl Depth Audit

Identifies pages buried beyond optimal crawl depth and recommends structural fixes.

Analyze the crawl depth distribution for {domain} using the provided crawl export. Flag any indexable pages beyond depth {max_depth}, group them by template type, and recommend internal linking or sitemap changes to bring them within crawl range...
auditcrawlindexing
Ranking v1.0

SERP Volatility Keyword Triage

Triages a keyword set by SERP volatility to focus optimization effort on stable opportunities.

Using rank tracking history for {keyword_list} over the past 90 days, calculate position standard deviation per keyword. Segment keywords into high, medium, and low volatility tiers, and output a prioritization matrix recommending which to target for quick wins vs. long-term investment...
rankingvolatilitykeyword
Content v1.0

Topic Cluster Hub-Spoke Spec

Designs a hub-and-spoke topic cluster architecture for a given seed topic.

Design a hub-and-spoke content cluster for the seed topic {topic}. Define the pillar page scope, identify 8–12 spoke subtopics with supporting keyword intent, specify internal link anchor text for each spoke-to-hub connection, and estimate organic traffic potential per spoke...
contentclusterarchitecture
Ranking v1.0

Video SERP Schema Opportunity Brief

Identifies video content lacking VideoObject schema and prioritizes implementation by SERP potential.

Audit the video content on {domain} for VideoObject schema coverage. For each video page missing required properties (name, description, thumbnailUrl, uploadDate, duration), output a schema template and prioritize by estimated search volume of the target query...
rankingvideo-serpschema
Technical v1.0

XML Sitemap Index Split Architect

Designs a scalable sitemap index structure split by content type and update frequency.

Design an XML sitemap index architecture for {domain} with {url_count} indexable URLs. Split child sitemaps by content type (product, blog, category, location), assign lastmod and changefreq values based on actual update cadence, and output the sitemap index XML plus child sitemap shell templates...
technicalsitemaparchitecture
GEO v1.0

ChatGPT Entity Citation Readiness Brief

Assesses whether a brand's entity signals are strong enough for ChatGPT to cite it reliably.

Evaluate the entity readiness of {brand_name} for ChatGPT citation across the topic cluster {topic_cluster}. Assess Wikipedia presence, Wikidata completeness, structured data entity declarations, third-party brand mentions, and knowledge graph signals. Output a gap-closure action plan ranked by impact...
chatgptentitygeo
Content v1.0

Content Gap Topic Cluster Map

Maps content gaps within a topic cluster and prioritizes creation by traffic and authority impact.

Analyze the existing content inventory of {site_url} within the topic cluster {topic_cluster}. Identify subtopics and supporting pages that are missing, thin, or outdated. Score each gap by estimated search volume, competitive difficulty, and topical authority contribution. Output a prioritized content creation roadmap...
content-gaptopic-clustercontent
Content v1.0

Content Refresh Traffic Impact Plan

Prioritizes content refresh candidates by forecasted traffic recovery after update.

Review the content performance data for {site_url} over the past {time_period}. Identify pages with declining organic traffic, high impressions but low CTR, or dropping average position. For the top 15 refresh candidates, output a prioritized plan with specific update actions and estimated traffic recovery impact...
content-refreshtrafficcontent
Content v1.0

E-E-A-T Author Credibility Brief

Builds an author credibility profile and page-level E-E-A-T enhancement plan for YMYL content.

For the author {author_name} publishing on {site_url} in the {topic_vertical} niche, audit their current E-E-A-T signals: author bio completeness, credential citations, external author mentions, linked social profiles, and byline consistency. Output a profile enhancement brief with specific copy recommendations...
e-e-a-tauthorcontent
Technical v1.0

Edge SEO Cloudflare Redirect Worker

Writes a Cloudflare Worker script to handle complex SEO redirect logic at the edge.

Write a Cloudflare Worker script for {site_url} that implements the following redirect rules: {redirect_rules}. The worker must handle 301 and 302 redirects, preserve query parameters where specified, log redirect events to a KV store, and avoid redirect loops. Include inline comments explaining each logic block...
cloudflareredirectstechnical
GEO v1.0

Entity Association Salience Scorer

Scores the salience of brand-entity associations across web content to model LLM knowledge.

Analyze the web footprint of {brand_name} in relation to the entity cluster {entity_list}. Score the co-occurrence frequency, contextual salience, and authoritative source density for each entity association. Identify which associations are weak and prescribe content actions to strengthen them...
entitysaliencegeo
Technical v1.0

Hreflang XML Sitemap Locale Matrix

Generates a complete hreflang XML sitemap with all locale return tags for international sites.

Generate a complete hreflang XML sitemap for {site_url} covering the following locale-URL pairs: {locale_url_matrix}. Ensure every URL entry includes hreflang annotations for all alternate locales and an x-default tag. Output the sitemap XML and a validation checklist for common hreflang errors...
hreflangsitemaptechnical
Audit v1.0

Indexing Coverage Gap Audit

Diagnoses why valuable pages are excluded from Google's index using Search Console coverage data.

Using the Google Search Console coverage report export for {site_url}, categorize all non-indexed URLs by exclusion reason. For each exclusion category containing more than {threshold} URLs, diagnose the root cause and provide a step-by-step remediation plan with expected impact...
indexingauditsearch-console
Technical v1.0

INP LCP CLS Element Trace Fix

Traces the specific DOM elements causing INP, LCP, and CLS failures and prescribes element-level fixes.

Using the CrUX field data and lab trace for {page_url}, identify the specific DOM elements responsible for poor INP (interaction delay), LCP (largest contentful paint resource), and CLS (layout shift sources). For each failing element, provide a targeted code-level fix with before/after implementation examples...
core-web-vitalstechnicalperformance
Audit v1.0

Internal Link Equity Distribution Audit

Maps internal link equity flow across a site and surfaces pages that are under- or over-linked.

Analyze the internal link graph export for {site_url}. Calculate relative internal PageRank for each page, identify the top 20 pages receiving disproportionately low equity relative to their revenue or traffic importance, and recommend specific linking actions to rebalance equity flow...
internal-linksequityaudit
GEO v1.0

LLM Source Recency Gap Audit

Identifies content on a site that is too stale to be cited by recency-sensitive LLM retrieval systems.

Review the content inventory for {site_url} targeting the topic cluster {topic_cluster}. For each page, assess publication date, last-modified date, factual freshness, and citation recency signals. Flag pages at risk of being bypassed by recency-sensitive LLM retrieval and output a refresh priority queue...
recencygeollm
GEO v1.0

Multi-LLM Citation Gap Matrix

Compares citation behavior across multiple LLMs to find where a brand is systematically missing.

Test the following query set {query_list} across ChatGPT, Claude, Perplexity, and Gemini. For each query, record which sources each LLM cites, then build a matrix identifying queries where {brand_name} is cited by zero or one LLM. Output a prioritized content and authority gap brief...
multi-llmgeocitation
Audit v1.0

Orphan Page Link Gap Identifier

Identifies orphan pages in a crawl export and recommends internal link placements to rescue them.

Using the crawl export CSV for {site_url}, identify all pages with zero internal inlinks that are indexed or indexable. For each orphan page cluster, recommend the top 3 contextually relevant pages from which to add internal links, specifying anchor text and placement context...
orphan-pagesinternal-linksaudit
GEO v1.0

Perplexity Citation Source Model

Models why Perplexity prefers certain sources over yours and identifies content gaps to close.

For the topic {topic} and query set {query_list}, retrieve Perplexity's top cited sources. For each cited competitor, identify the specific content attributes (depth, format, entity coverage, recency) that likely drive citation preference over {brand_site}. Output a prioritized content gap brief...
perplexitygeocitation
Technical v1.0

Prerender Eligibility Technical Spec

Evaluates whether pages qualify for prerendering and generates the implementation configuration.

Evaluate the prerendering eligibility of {site_url} pages for {user_agent_targets}. Assess JavaScript dependency complexity, dynamic content requirements, authenticated content blocks, and prerender service compatibility. For eligible page types, output a prerender configuration spec with routing rules and cache invalidation logic...
prerenderingrenderingtechnical
Audit v1.0

Schema Markup Type Audit

Audits which schema types are implemented, missing, or misconfigured across a site's key templates.

Audit the schema markup implementation for {site_url}. For each page template (homepage, product, article, FAQ, local business), identify which Schema.org types are present, which are absent relative to SERP opportunities, and flag any property-level errors or missing required fields...
schemaauditstructured-data
Ranking v1.0

SERP Volatility Cause Analysis

Diagnoses the root cause of sudden ranking drops or volatility using SERP and algorithm data.

Analyze the ranking volatility for {site_url} across the date range {date_range}. Cross-reference position changes with known algorithm updates, SERP feature changes, and competitor content shifts. For the top 20 most volatile URLs, identify likely root causes and prescribe stabilization actions...
volatilityrankingalgorithm
Ranking v1.0

SERP Intent Classification Matrix

Classifies a keyword list by SERP intent type and maps each to the optimal content format.

Classify the following keyword list {keyword_list} by SERP intent (informational, navigational, commercial, transactional) using live SERP feature analysis. For each intent cluster, identify the dominant content format winning top-3 positions and recommend the optimal page type and structure for {site_url}...
intentrankingserp
Content v1.0

Title Meta CTR Rewrite Batch

Rewrites title tags and meta descriptions for low-CTR pages using SERP emotional trigger analysis.

For the following pages with below-average CTR from Search Console data: {url_list}, rewrite each title tag (max 60 chars) and meta description (max 155 chars). For each rewrite, apply power words, primary keyword placement, and a clear value proposition. Output in a CSV format: URL, new title, new meta description...
title-tagsctrcontent
Technical v1.0

XML Sitemap Index Split Engineer

Designs a sitemap index architecture splitting URLs by template type for optimal crawl prioritization.

Design a sitemap index architecture for {site_url} with {total_url_count} URLs. Split sitemaps by page template type: {template_types}. For each child sitemap, specify URL inclusion criteria, lastmod signal strategy, priority and changefreq recommendations, and the sitemap index XML structure. Output all XML code blocks...
sitemaptechnicalcrawl
GEO v1.0

AEO Topical Gap Content Brief

Generates a content brief targeting answer engine optimization gaps for a defined topical cluster.

For the topical cluster {topic} on {domain}, identify all question-intent queries where {domain} currently lacks content or is not cited by answer engines (Perplexity, ChatGPT, AI Overviews). For each gap query, produce a content brief including: answer format, required entities, recommended word count, and schema type...
geoaeocontent-brief
GEO v1.0

Brand Mention Context Auditor

Audits the context in which a brand is mentioned across web sources to identify negative or missing association signals.

Review the following corpus of web mentions for {brand}. Classify each mention by: sentiment (positive/neutral/negative), topical context, mention prominence (anchor vs. body text), source authority, and whether the mention reinforces desired brand associations. Output a context gap report with outreach priorities...
geobrand-mentionsentity-association
Ranking v1.0

Branded vs Non-Branded Intent Split

Splits a keyword portfolio into branded and non-branded segments and analyzes intent distribution for each.

Segment the following keyword list for {domain} into branded and non-branded groups. For each segment, calculate: impression share, average position, CTR, conversion rate (if available), and dominant intent type. Identify where branded terms are cannibalizing non-branded rankings and recommend SERP ownership strategies...
rankingbrandedintent
Audit v1.0

Broken Link Severity Triage

Prioritizes broken internal and external links by PageRank impact and user experience severity.

Given the following list of broken links (4xx/5xx) found on {domain}, score each by: source page authority, number of internal links pointing to the source, anchor text relevance, and whether the broken URL is referenced in the sitemap. Output a priority-ranked fix list with recommended actions...
auditbroken-linkslink-equity
Ranking v1.0

Competitor Content Gap Ranker

Ranks content gap opportunities by traffic potential where competitors rank but the target domain does not.

Using the keyword ranking data for {domain} and competitors {competitor_1}, {competitor_2}, {competitor_3}, identify all keywords where at least two competitors rank in the top 10 but {domain} does not appear in the top 30. Score each gap by estimated monthly search volume and keyword difficulty, and output a prioritized opportunity list...
rankingcompetitor-gapkeyword-research
Content v1.0

Content Brief Intent Aligned

Generates a full content brief aligned to dominant SERP intent for a target keyword.

Create a comprehensive content brief for the target keyword '{keyword}' on {domain}. Analyze the top 10 SERP results to determine dominant intent, preferred content format, average word count, common subheadings, and featured entities. Include: recommended title, H2/H3 structure, E-E-A-T signals to include, internal link targets, and schema markup recommendation...
contentcontent-briefintent
Audit v1.0

Duplicate Content Parameter Finder

Identifies URL parameter combinations generating duplicate or near-duplicate content at scale.

Review the following list of URLs with query parameters for {domain}. Cluster URLs that produce identical or near-identical page content, identify the parameter keys responsible, and recommend canonical, noindex, or robots.txt solutions for each duplicate cluster...
auditduplicate-contentparameters
Content v1.0

FAQ Intent Cluster Generator

Generates clustered FAQ sections optimized for PAA capture and FAQ schema eligibility for a topic.

For the topic '{topic}' on {domain}, generate a set of {n} FAQ questions and answers optimized for People Also Ask capture and FAQ rich result eligibility. Group questions into intent sub-clusters (how-to, what-is, comparison, troubleshooting). Each answer should be 40–60 words, factually specific, and include a schema-ready JSON-LD block...
contentfaqrich-results
Ranking v1.0

Featured Snippet Format Gap

Identifies keyword targets where a format change (paragraph/list/table) would unlock featured snippet wins.

Analyze the following keywords where {domain} ranks in positions 2–10 but does not hold the featured snippet. For each keyword, identify the current snippet format (paragraph, list, table, or code), the structural gap in {domain}'s current content, and provide a specific rewrite recommendation to capture the snippet...
rankingfeatured-snippetcontent-format
GEO v1.0

Generative SERP Source Preference Audit

Identifies which content formats and source types generative SERPs prefer when selecting citations.

For the following {n} generative SERP results on {topic}, catalog the source types cited (news, academic, brand, UGC, etc.), content formats (listicle, how-to, study, etc.), and structural signals (schema, headers, tables). Produce a source preference model and recommend format adjustments for {domain}...
geogenerative-serpsource-preference
Ranking v1.0

Image SERP Schema Optimizer

Identifies structured data and metadata gaps preventing images from ranking in Google Image SERP.

Audit the following image-heavy pages on {domain} for Image SERP ranking signals. For each page, check: ImageObject schema presence, file naming conventions, alt text specificity, caption quality, page topical relevance, and loading performance. Produce a scored gap table and prioritized fix list...
rankingimage-serpstructured-data
GEO v1.0

LLM Recency Freshness Gap Scanner

Identifies content on a domain that is too stale to be cited by LLMs with recency-weighted retrieval.

Review the following pages on {domain} that target time-sensitive queries in {topic_category}. For each page, assess: publication date, last-updated signal, presence of dated statistics, and whether competing LLM-cited sources are more recently updated. Output a staleness risk score and refresh priority queue...
georecencycontent-freshness
GEO v1.0

LLM Source Authority Builder

Models the authority signals that make a domain a preferred source for LLM citation across topics.

Analyze the following domains that are frequently cited by LLMs for {topic_category}. Identify the common authority signals (domain age, backlink profile, content depth, structured data, author credentials, citation by academic/news sources) and produce a gap analysis showing what {domain} must build to compete...
geosource-authorityllm-citation
Ranking v1.0

Local Pack Signal Gap Audit

Audits local pack ranking signals for a GBP listing vs. top competitors in a target market area.

Compare the Google Business Profile signals for {business_name} against the top 3 local pack competitors for {target_keyword} in {location}. Analyze: review volume and rating, category accuracy, NAP consistency, photo count, post frequency, service area definition, and citation quality. Output a gap-ranked action plan...
rankinglocal-seogoogle-business-profile
GEO v1.0

Multi-LLM Topic Coverage Tester

Tests how consistently multiple LLMs cover a brand or topic and surfaces answer variance gaps.

Submit the following {n} queries about {topic} to ChatGPT, Claude, Gemini, and Perplexity. For each query, record: whether {brand} is mentioned, the sentiment, the supporting sources cited, and the accuracy of brand attributes. Produce a cross-LLM variance matrix and identify which gaps to address first...
geomulti-llmbrand-coverage
Audit v1.0

Orphan Page Link Sweep

Detects orphan pages with no internal links pointing to them and recommends link insertion opportunities.

Given the crawl data and internal link map for {domain}, identify all URLs that receive zero internal links (orphan pages). For each orphan page, suggest the top 3 existing pages that should link to it, including recommended anchor text and placement rationale...
auditinternal-linksorphan-pages
Ranking v1.0

People Also Ask Intent Map

Maps PAA questions to content gaps and FAQ schema opportunities across a target keyword cluster.

For the seed keyword cluster {topic} on {domain}, extract all People Also Ask questions from the top 20 SERPs. Group questions by sub-topic, classify their intent, identify which questions {domain} currently answers (and how well), and output a gap matrix with recommended FAQ schema blocks and content placements...
rankingpaafaq
GEO v1.0

Perplexity Citation Competitor Mapper

Maps which competitor domains Perplexity cites for a given topic set and identifies citation gaps.

For the following {n} queries related to {topic}, record which domains Perplexity cites in its answers. Build a competitor citation frequency table, identify which content types and page formats earn citations, and highlight gap opportunities where {domain} is absent but competitors dominate...
geoperplexitycitation-analysis
Technical v1.0

Prerender Eligibility SEO Spec

Evaluates URL eligibility for browser prerendering and configures Speculation Rules API for SEO benefit.

Evaluate which URLs on {domain} are eligible for browser prerendering using the Speculation Rules API. Define: eligibility criteria (no auth-required pages, no single-use tokens, no side-effect-on-load pages), the JSON speculation rules block to add to page templates, how to measure prerender impact via CrUX and GSC, and fallback behavior for ineligible URLs...
technicalprerenderingperformance
Audit v1.0

Redirect Chain Length Checker

Traces multi-hop redirect chains and flags those exceeding acceptable depth thresholds.

Analyze the following redirect map for {domain}. Identify all redirect chains exceeding 2 hops, flag redirect loops, and calculate PageRank dilution risk for each chain. Output a CSV-ready table with: source URL, chain depth, final destination, redirect types, and fix recommendation...
auditredirectscrawl-budget
Ranking v1.0

SERP Volatility Root Cause

Diagnoses the likely cause of ranking volatility for a keyword set by correlating rank changes with known signals.

Given the ranking history data for the following keywords on {domain} over the past {n} weeks, correlate rank fluctuations with: known algorithm updates, content change dates, backlink acquisition/loss events, SERP feature changes, and competitor content updates. Output a volatility cause hypothesis table with confidence scores...
rankingvolatilityalgorithm
Ranking v1.0

SERP Intent Gap Classifier

Classifies a keyword list by search intent type and flags pages misaligned with dominant SERP intent.

For the following keyword list targeting {domain}, classify each keyword by dominant SERP intent (informational, navigational, commercial, transactional) using the top-10 SERP results as evidence. Flag any {domain} pages currently ranking where the page type mismatches the dominant intent, and recommend content format corrections...
rankingintentserp-analysis
Technical v1.0

XML Sitemap Index Architect

Designs a split sitemap index architecture for large sites with over 50,000 URLs across content types.

Design an XML sitemap index architecture for {domain}, which has {url_count} total indexable URLs across the following content types: {content_types}. Specify: how to split sitemaps by content type and priority tier, the ideal sitemap file size limits, lastmod and priority attribute strategy, and how to declare the sitemap index in Search Console and robots.txt...
technicalsitemapcrawl-budget
GEO v1.0

AI Mode Content Slot Analyzer

Identifies content slots in Google AI Mode responses and maps them to optimizable page sections.

For the query set {query_list}, capture the AI Mode response structure in Google Search. Identify recurring content slots (definitions, comparisons, step lists, FAQs, product recommendations). For each slot type, assess whether {site_url} has content that fits the required format and recommend page-level edits to improve slot inclusion...
geoai-modecontent-slots
Content v1.0

Anchor Text Diversity Internal Planner

Audits internal anchor text distribution and plans a diversified anchor text strategy for target pages.

Analyze the internal links pointing to {target_url} across {site_url}. Categorize all existing anchor texts as: exact-match, partial-match, branded, generic, or naked URL. Assess whether the distribution creates over-optimization risk for {target_keyword}. Generate a recommended anchor text distribution plan and draft 10 varied anchor text options for future internal links to this page...
contentanchor-textinternal-links
Ranking v1.0

Branded Query CTR Impression Plan

Analyzes branded query impression share and CTR to identify sitelink and title optimization opportunities.

Using the Google Search Console data for {site_url}, filter all queries containing {brand_name}. Identify branded queries with impression share below 90%, CTR below {ctr_benchmark}%, or average position outside position 1-3. For each underperforming branded query, recommend title tag, meta description, sitelink, or Knowledge Panel actions to improve performance...
rankingbrandedctr
Audit v1.0

Canonical Tag Self-Referential Audit

Reviews canonical tags across a site to detect missing self-referentials and conflicting signals.

Review the canonical tag implementation for the URLs listed below from {site_url}. Flag any page missing a self-referential canonical, any canonical pointing to a redirect, any canonical pointing to a 4xx page, and any case where the on-page canonical conflicts with the HTTP header canonical...
auditcanonicalindexing
Technical v1.0

CDN Cache-Control SEO Audit

Audits CDN cache-control headers to identify configurations that impair Googlebot crawl freshness.

Analyze the Cache-Control and Surrogate-Control headers returned by {cdn_provider} for the URL samples below from {site_url}. Identify any pages with max-age values too high for frequently updated content, pages returning no-store or no-cache that should be cached, and pages where CDN caching causes Googlebot to receive stale content. Provide recommended header configurations for each page type...
technicalcdncache-control
Technical v1.0

Cloudflare Worker SEO Header Spec

Writes a Cloudflare Worker script to inject or modify SEO-critical HTTP headers at the edge.

Write a Cloudflare Worker script for {site_url} that: adds X-Robots-Tag headers with 'noindex' for all URLs matching the pattern {noindex_pattern}, sets canonical HTTP Link headers for paginated URLs, injects Cache-Control headers appropriate for SEO crawling on static pages, and adds security headers (HSTS, X-Frame-Options, CSP) without breaking existing functionality...
technicaledge-seocloudflare
Content v1.0

Content Brief SERP Feature Alignment

Generates a content brief engineered to target multiple SERP features simultaneously for one query.

Create a detailed content brief for the target query {target_query} that is simultaneously optimized to capture a featured snippet, appear in the People Also Ask box, and be cited in AI Overviews. For each SERP feature, specify the required content format, ideal answer length, heading structure, and entity signals the final article must include...
contentbriefserp-features
Content v1.0

Content Gap Competitor Cluster Map

Maps competitor content clusters to expose sub-topic gaps your site lacks coverage for.

Analyze the content structure of {competitor_domain} for the topic {topic}. Identify every sub-topic cluster they have published content on. Cross-reference against the content inventory of {site_url} and produce a gap matrix showing which sub-topics are covered by the competitor but absent from your site, ranked by estimated monthly search volume...
contentgap-analysiscompetitor
Audit v1.0

Core Web Vitals CrUX Device Split

Breaks down CrUX field data by device type to isolate mobile vs desktop CWV failures.

Using the CrUX field data provided for {site_url}, separate LCP, INP, and CLS scores by device type (mobile, tablet, desktop). For each metric that fails the 'Good' threshold on any device segment, identify the top contributing page templates and suggest root-cause fixes...
auditcore-web-vitalscrux
Content v1.0

E-E-A-T Author Bio Schema Builder

Drafts an author bio and Person schema markup optimized to demonstrate E-E-A-T for a given topic.

For the author {author_name} who writes about {topic} on {site_url}, draft an on-page author bio (150-200 words) that explicitly signals first-hand experience, expertise credentials, and external validation. Also generate a complete JSON-LD Person schema block for this author that includes sameAs references to LinkedIn, published works, and relevant organization affiliations...
contente-e-a-tschema
GEO v1.0

Entity Association Prominence Scorer

Scores how prominently a brand entity is associated with target topics across LLM knowledge bases.

Evaluate the association strength between {brand_name} and each of the following topics: {topic_list}. Test each association by prompting ChatGPT and Perplexity with topic-first questions and recording unprompted brand mentions. Score each topic 0-10 for association prominence and rank them by improvement opportunity based on organic search volume...
geoentitybrand-association
Audit v1.0

Faceted Nav Parameter Crawl Waste

Identifies URL parameter combinations from faceted navigation that waste crawl budget on duplicate content.

Analyze the URL parameter patterns from the crawl export of {site_url}. Identify which faceted navigation parameter combinations produce near-duplicate pages, estimate the crawl budget consumed by each parameter type, and recommend whether each should be handled via robots.txt disallow, noindex, canonical, or URL parameter tools...
auditfaceted-navcrawl-budget
Content v1.0

FAQ Block PAA Intent Generator

Generates FAQ content blocks derived directly from People Also Ask data for a target keyword.

For the target keyword {target_keyword}, extract the People Also Ask questions from the first three levels of expansion. Group the questions by intent type (how-to, what-is, comparison, troubleshooting). For each question, write a direct answer of 40-60 words optimized for PAA and featured snippet capture, then generate the FAQPage JSON-LD schema block for all answers...
contentfaqpaa
GEO v1.0

Generative SERP Feature Targeting Brief

Builds a targeting plan to earn inclusion in generative SERP features for a specific topic cluster.

For the topic cluster {topic_cluster}, identify which generative SERP features (AI Overviews, SGE carousels, AI Mode panels) currently appear on the top 20 queries. For each feature type, describe the content format, entity signals, and source authority required to earn inclusion, and map these requirements to actionable content briefs for {site_url}...
geogenerative-serpai-overview
Technical v1.0

Hreflang XML Sitemap Index Builder

Generates an hreflang-annotated XML sitemap structure for a multi-locale site.

For the multi-locale site {site_url} with the following locale and URL mapping: {locale_url_map}, generate a complete XML sitemap index that includes per-locale sitemap files. Each child sitemap must contain xhtml:link hreflang annotations for all alternate locale versions of each URL, including x-default. Validate that all return tags are present and output the full XML for each sitemap file...
technicalhreflangsitemap
Audit v1.0

Image SEO Alt Text Sweep

Audits all images across a crawl export for missing, duplicate, or keyword-stuffed alt attributes.

Using the crawl export below for {site_url}, analyze every img element found across all pages. Categorize images as: missing alt, empty alt, duplicate alt, keyword-stuffed alt, or optimized. For images in the first two categories on high-traffic pages, draft improved alt text based on surrounding context...
auditimage-seoaccessibility
Ranking v1.0

Knowledge Panel Entity Attribute Gaps

Compares current Knowledge Panel attributes against competitor panels to find missing entity signals.

Review the Google Knowledge Panel for {brand_name} and compare its populated attributes (description, founding date, founders, social profiles, products, Wikipedia link) against the panels of {competitor_list}. List every attribute present in competitor panels but missing or incorrect in {brand_name}'s panel, and provide specific actions to add or correct each signal...
rankingknowledge-panelentity
Audit v1.0

Log File Bot Frequency Review

Parses server log data to reveal Googlebot crawl frequency patterns and wasted crawl budget.

Using the server log excerpt below for {site_url}, segment all Googlebot requests by URL, HTTP status code, and crawl frequency over the past {time_period}. Highlight URLs that are crawled frequently but return non-200 status codes or are low-value pages...
auditlog-filecrawl-budget
GEO v1.0

Multi-LLM Citation Consistency Tester

Tests the same query across multiple LLMs to find citation variance and brand visibility gaps.

Submit the query '{target_query}' to ChatGPT, Claude, Perplexity, and Gemini. For each response, record: whether {brand_name} is mentioned, the position of the mention, the sentiment, and the source cited if any. Produce a cross-LLM visibility matrix and recommend content or authority actions to close gaps...
geomulti-llmbrand-visibility
Ranking v1.0

People Also Ask Intent Tree Builder

Recursively maps PAA questions to build a full intent tree for a seed topic.

Starting with the seed query {seed_query}, recursively expand the People Also Ask box for three levels of depth. Map all discovered questions into a hierarchical intent tree, classify each node by intent type and funnel stage, and identify which questions {site_url} currently has content addressing versus gaps requiring new content creation...
rankingpaaintent-mapping
GEO v1.0

Perplexity Source Domain Profile

Profiles the domains Perplexity repeatedly cites for a topic to reveal source authority patterns.

Run the following 10 queries related to {topic} in Perplexity and record every cited domain and URL. Produce a frequency table of cited domains, identify what content types (articles, guides, studies, forums) are favored, and assess what signals distinguish cited pages from non-cited competitor pages on the same topic...
geoperplexitysource-authority
Technical v1.0

Prerender SEO Bot Detection Spec

Specifies bot-detection logic for a prerendering setup to serve static HTML to crawlers accurately.

Design a bot-detection middleware specification for the prerendering solution on {site_url}. The spec must define: the user-agent list of bots to serve prerendered HTML to, the logic to exclude human users and paid ad bots (to avoid cloaking), cache TTL settings per page type, rules for bypassing prerender on excluded URL patterns, and monitoring hooks to detect when prerendered content diverges from live content by more than {diff_threshold}%...
technicalprerenderbot-detection
Technical v1.0

Robots.txt Crawl Directive Builder

Generates a robots.txt file with directives tailored to protect crawl budget for a specific site architecture.

Based on the site architecture description for {site_url} below, generate a robots.txt file that: disallows crawling of {disallow_paths}, sets crawl-delay only for non-Googlebot bots where appropriate, references the correct XML sitemap location, and includes comments explaining the purpose of each directive. Validate that the rules do not accidentally block any indexable page...
technicalrobots-txtcrawl-budget
Audit v1.0

Schema Markup Type Gap Audit

Compares implemented schema types against competitor pages to find missing structured data opportunities.

Review the schema markup currently deployed on {site_url} and compare it against the top 5 SERP competitors for the query {target_query}. List every schema type present on competitor pages but absent from {site_url}, and rank them by rich-result eligibility...
auditschemarich-results
Ranking v1.0

SERP Intent Mismatch Content Fixer

Diagnoses pages ranking for queries where content intent mismatches SERP dominant intent.

For each keyword in {keyword_list}, classify the dominant SERP intent (informational, navigational, commercial, transactional) based on the top 10 results. Compare this to the intent of the ranking page on {site_url}. For every mismatch, recommend whether to rewrite the existing page, create a new page, or adjust the content format to align with dominant intent...
rankingintentserp
Content v1.0

Schema-Rich How-To Content Brief

Creates a content brief for a how-to article structured to earn HowTo schema rich results.

Generate a complete content brief for a how-to article targeting the query {target_query}. The brief must specify: a step-by-step structure with 5-10 discrete steps, each step's required content elements (name, text, image description), estimated time and total duration, required tools or materials, and the complete HowTo JSON-LD schema block to be implemented on the final page...
contenthow-toschema
Ranking v1.0

SERP Volatility Cause Classifier

Classifies ranking volatility events by likely cause to prioritize the correct SEO response.

Given the ranking history data for {site_url} over the past {time_period}, identify all positions that moved by more than 5 places in a single week. For each volatility event, cross-reference with Google algorithm update dates, competitor content changes, and SERP feature introduction dates. Classify each event as algorithm-driven, competitor-driven, or content-quality-driven, and recommend the appropriate response...
rankingvolatilityalgorithm
Ranking v1.0

Video SERP Schema Eligibility Audit

Reviews video pages for VideoObject schema completeness and key moments markup eligibility.

For each video page listed in {url_list} on {site_url}, audit the VideoObject schema implementation for required properties (name, description, thumbnailUrl, uploadDate, duration, contentUrl). Identify missing or malformed properties and assess eligibility for Key Moments markup by checking whether the video has a timestamped transcript or chapters...
rankingvideo-serpschema
Technical v1.0

XML Sitemap Index Health Engineer

Diagnoses sitemap index errors and engineers a corrected sitemap structure for large sites.

Audit the XML sitemap index at {sitemap_url} for {site_url}. Check for: child sitemaps exceeding 50,000 URLs or 50MB uncompressed, URLs in sitemaps that return non-200 status codes, URLs blocked by robots.txt, lastmod dates that are inaccurate or missing, and any sitemap URLs not referenced in the sitemap index. Produce a corrected sitemap architecture specification and prioritized fix list...
technicalsitemapcrawl
GEO v1.0

AI Overview Source Eligibility Scorer

Scores a page's likelihood of being selected as an AI Overview source across key eligibility signals.

Evaluate the following page {page_url} against Google AI Overview source eligibility signals including: E-E-A-T indicators, passage-level clarity, factual density, structured formatting, and query match for {target_query}. Score each signal 1–10 and output a prioritized optimization checklist...
geoai-overvieweligibility
Ranking v1.0

Branded Query SERP Dominance Plan

Creates a SERP dominance strategy to own page-one results for branded and near-branded queries.

For the brand {brand_name}, audit the current page-one SERP for the top 10 branded queries: {branded_query_list}. Identify positions owned by third-party sites (review sites, social profiles, news) versus owned properties. Output a SERP ownership strategy covering: site links expansion, knowledge panel, profile optimization, and content targets...
rankingbrandedserp
Technical v1.0

CDN Cache SEO Header Audit

Audits CDN cache header configuration to identify settings that harm SEO crawlability or freshness.

Audit the CDN cache header configuration for {site_url} using the following HTTP response header samples: {header_samples_csv}. Identify: (1) Cache-Control directives that may cause stale content to be served to Googlebot, (2) missing Vary headers causing content negotiation issues, (3) over-caching of dynamic or personalized pages. Output a configuration fix spec...
technicalcdncaching
GEO v1.0

Citation Pre-Publish Signal Audit

Runs a pre-publication checklist to maximize a new article's citation potential in AI responses.

Before publishing the article {article_title} at {target_url}, evaluate it against the following LLM citation readiness signals: factual density per 100 words, entity disambiguation clarity, passage answerability score, heading structure, and E-E-A-T author signals. Output a pass/fail checklist with specific edits...
geocitationpre-publish
Technical v1.0

Cloudflare Worker SEO Header Injector

Writes a Cloudflare Worker script to inject SEO-critical HTTP headers at the edge without origin changes.

Write a Cloudflare Worker script for {site_url} that injects the following HTTP response headers at the edge: {header_list} (e.g., X-Robots-Tag, Link rel=canonical, Cache-Control, Content-Security-Policy). The script must apply headers conditionally based on URL path patterns: {path_pattern_rules}. Output production-ready Worker code with inline comments...
technicalcloudflareedge-seo
Content v1.0

Content Decay Cluster Recovery Plan

Groups decaying content into recovery clusters and assigns refresh, merge, or retire actions.

Analyze the following traffic decay report for {site_url}: {decay_data_csv}. Group declining URLs into clusters by topic similarity and assign each cluster a recovery action: (1) refresh in place, (2) merge into a hub page, (3) redirect to a stronger URL, or (4) retire and reclaim links. Output a prioritized cluster recovery plan with effort estimates...
contentdecayrefresh
Ranking v1.0

Competitor Content SERP Gap Finder

Finds keywords where competitors rank in top 10 but your site has no ranking URL.

Using the following competitor keyword ranking exports for {competitor_domains} and your site {site_url}: {ranking_data_csv}, identify keywords where at least two competitors rank in positions 1–10 but {site_url} has no ranking URL. Cluster gaps by topic, estimate opportunity size, and output a prioritized content creation list...
rankingcompetitor-gapkeywords
Content v1.0

FAQ Intent Schema Block Writer

Writes FAQ content blocks with embedded FAQPage schema targeting PAA and rich result opportunities.

Generate a FAQ content block for the page targeting {target_keyword} on {site_url}. Include 5–8 questions drawn from PAA boxes and related searches. For each question, write a concise answer (40–60 words), then output the complete FAQPage JSON-LD schema block. Ensure answers are optimized for featured snippet extraction...
contentfaqschema
GEO v1.0

GEO Content Brief Passage Depth

Builds a GEO-optimized content brief focused on passage-level depth for AI citation retrieval.

Create a GEO content brief for the topic {topic} targeting citation in AI Overviews and LLM responses. Include: recommended passage structure, required factual claim density, entity co-occurrence targets, ideal heading formats, and source-authority signals. Output as a structured brief template...
geocontent-briefpassage
Content v1.0

How-To Schema Content Drafter

Drafts a How-To article with embedded HowTo schema optimized for rich result eligibility.

Draft a How-To article for the topic {how_to_topic} targeting the keyword {target_keyword}. Structure the article with a clear introduction, numbered steps (each 40–80 words), required tools/materials list, and a tips section. Output the article followed by a complete HowTo JSON-LD schema block with all required and recommended properties...
contenthow-toschema
Ranking v1.0

Image SERP Schema Opportunity Finder

Identifies image SERP opportunities for a site and maps required schema and metadata improvements.

Analyze the image assets on {site_url} for the following target queries: {query_list}. For each query, identify whether competitor images appear in Google Image SERP, what schema markup and alt text patterns they use, and output a structured optimization brief for {site_url}'s images to improve image SERP visibility...
rankingimage-serpschema
Audit v1.0

JS Rendering Content Visibility Audit

Compares raw HTML vs rendered DOM to identify content invisible to Googlebot before JS execution.

Compare the raw HTML source and fully rendered DOM for the following URLs on {site_url}: {url_list}. Identify all meaningful content, internal links, and schema markup present only in the rendered DOM but absent from the raw HTML. Classify each gap by SEO impact (critical/moderate/low) and suggest fix strategy...
auditjavascriptrendering
Technical v1.0

LCP Resource Load Chain Analyzer

Traces the LCP element's resource load chain to identify render-blocking delays and optimization fixes.

Analyze the LCP resource load chain for {page_url} using the following WebPageTest waterfall data: {waterfall_data}. Identify the LCP element, trace all blocking resources in its critical path (render-blocking CSS/JS, LCP image discovery delay, server TTFB contribution), and output a ranked fix list with expected LCP improvement estimates in milliseconds...
technicallcpcore-web-vitals
Ranking v1.0

Local Pack Signal Gap Mapper

Maps the local pack ranking signal gaps between your GBP listing and top-3 pack competitors.

Compare the Google Business Profile signals for {business_name} against the top 3 local pack competitors for the query {local_query} in {location}. Analyze: review count/velocity, category alignment, attribute completeness, citation consistency, and proximity factors. Output a prioritized gap-fix matrix...
rankinglocal-packgbp
GEO v1.0

Multi-LLM Passage Coverage Test

Tests whether a target passage appears in responses from multiple LLMs for the same query.

For the query {target_query}, submit it to ChatGPT, Claude, Perplexity, and Gemini. Record whether the following target passage from {source_url} appears (verbatim or paraphrased) in each response. Output a coverage matrix with passage presence score, paraphrase similarity score, and LLM-specific optimization recommendations...
geomulti-llmpassage
Ranking v1.0

PAA Question Intent Expansion

Expands a seed keyword into a PAA question tree with intent classification and content recommendations.

For the seed keyword {seed_keyword}, generate a three-level People Also Ask question expansion tree. For each question, classify the intent type, identify the most likely SERP format that answers it (featured snippet, paragraph, list, table), and recommend a content element (FAQ block, section heading, standalone article) to target it...
rankingpaaintent
Technical v1.0

SSR Hydration SEO Configuration

Configures server-side rendering hydration settings to ensure full SEO content visibility at first byte.

Review the SSR hydration configuration for {site_url} built on {framework} (e.g., Next.js, Nuxt, SvelteKit). Identify components that are client-side only or lazy-loaded post-hydration that contain SEO-critical content (headings, body text, internal links, schema). Output a hydration fix spec ensuring all critical content is present in the initial HTML response...
technicalssrrendering
Audit v1.0

Technical Site Crawl Blueprint

Generates a structured crawl audit plan covering depth, scope, and priority signals for any site.

You are a senior technical SEO. Given the site {site_url}, produce a full crawl audit blueprint covering crawl depth limits, priority URL segments, expected issue types (redirects, canonical conflicts, orphans), and recommended tooling. Output as a numbered checklist...
auditcrawltechnical
GEO v1.0

AI Mode Query Topical Fit Scorer

Scores a site's content against AI Mode query patterns to forecast topical representation likelihood.

Given the following list of AI Mode queries observed for the {industry} niche {query_list}, evaluate how well {site_url} content aligns with each query's expected answer format and topical depth. Score each query 1-10 for: content match, entity coverage, passage extractability, and source authority. Identify the top 10 queries with the highest gap score for priority content investment...
geoai-modetopical-authority
Content v1.0

Topic Cluster Hub Content Brief

Creates a pillar page content brief that anchors a topic cluster and captures broad informational intent.

Build a pillar page content brief for the cluster topic {cluster_topic} on {site_url}. The hub page must cover all cluster subtopics at an introductory level and link to {spoke_count} spoke pages. Include: content scope, required subtopic sections, internal link anchor text recommendations, schema type, and target word count range...
contenttopic-clusterpillar
Ranking v1.0

Branded Query SERP Ownership Plan

Develops a strategy to maximize brand-controlled results for navigational branded query SERPs.

Audit the SERP for the top {num_queries} branded queries for '{brand_name}'. For each query, document: (1) positions held by brand-owned properties, (2) third-party results appearing (review sites, news, competitors), (3) SERP features present (sitelinks, knowledge panel, social profiles), and (4) gaps where negative or off-message results appear. Produce a SERP ownership action plan to maximize brand-controlled positions...
rankingbranded-serpbrand
Audit v1.0

Canonical Chain Conflict Sweeper

Detects self-referential, chained, and conflicting canonical tags across a URL set.

Analyze the following URL dataset for {site_url} (columns: page_url, canonical_tag_value, http_header_canonical, og_url). Identify: (1) non-self-referencing canonicals that chain through multiple hops, (2) canonical conflicts between HTTP header and HTML tag, (3) canonicals pointing to noindexed or redirected URLs, and (4) missing canonical tags on paginated pages...
auditcanonicalduplicate-content
Content v1.0

Content Decay Traffic Loss Finder

Identifies pages with significant organic traffic decline and diagnoses the root decay cause.

Analyze the following Google Search Console performance export for {site_url} (date ranges: {period_1} vs. {period_2}, columns: page, clicks, impressions, ctr, position). Identify pages with >25% click decline. For each decaying page, diagnose the likely cause: (1) ranking position loss, (2) CTR degradation, (3) impression collapse (demand drop), or (4) SERP feature displacement. Prioritize by traffic loss volume and recommend recovery action...
contentcontent-decaytraffic
Content v1.0

Content Gap Topic Cluster Builder

Identifies content gaps within an existing topic cluster and prioritizes new supporting pages.

Analyze the existing content cluster for the pillar topic '{pillar_topic}' on {site_url}. Given the current supporting page list {existing_pages} and the competitor content inventory from {competitor_list}, identify: (1) subtopics covered by 2+ competitors but absent from the site, (2) PAA questions not addressed by any existing page, (3) long-tail keyword clusters without a matching URL. Prioritize gaps by traffic opportunity and cluster coherence...
contentcontent-gaptopic-cluster
Content v1.0

FAQ Block Entity Intent Builder

Generates FAQ blocks optimized for PAA capture and FAQPage schema markup for a target page.

Generate a FAQ block for the page '{page_topic}' on {site_url} targeting the keyword cluster '{keyword_cluster}'. Requirements: (1) 8-12 questions derived from PAA data, forum threads, and 'People Also Search For' results, (2) each answer 40-60 words optimized for PAA box extraction, (3) entities ({entity_list}) mentioned naturally in answers, (4) FAQPage JSON-LD schema block ready for implementation. Include a note on which questions target featured snippet format...
contentfaqschema
Ranking v1.0

Featured Snippet Format Gap Fixer

Identifies ranking pages near featured snippet positions and prescribes format changes to capture the box.

Review the following pages for {site_url} that rank positions 2-10 for queries currently showing featured snippets (data: keyword, current_position, snippet_format, snippet_holder_url). For each page: (1) identify the snippet format type (paragraph, list, table, video), (2) audit the current page format against the snippet format, (3) provide specific HTML/content edits to match the snippet format and trigger capture...
rankingfeatured-snippetserp
Technical v1.0

Hreflang Matrix Return Tag Builder

Generates a complete hreflang tag matrix with return tags for a multilingual URL set.

Generate the complete hreflang link tag set for the following multilingual page group: {url_locale_table} (columns: locale_code, full_url). Requirements: (1) every locale must include a return tag from all others, (2) include x-default tag pointing to {default_url}, (3) validate language and region code format against BCP 47 standard, (4) output both HTML link tag format and XML sitemap hreflang format. Flag any missing return tag pairs...
technicalhreflanginternational
Audit v1.0

Indexing Gap GSC Audit

Cross-references GSC index coverage report reasons with crawl data to diagnose indexing exclusions.

Given the Google Search Console Index Coverage export for {site_url} (columns: URL, coverage_status, last_crawled, reason), cross-reference with the sitemap URL list and crawl log. For each exclusion reason (Crawled – currently not indexed, Discovered – currently not indexed, Blocked by robots.txt, etc.), identify the top contributing URL patterns and root causes...
auditindexinggsc
Content v1.0

Internal Link Depth Gap Planner

Analyzes internal link depth distribution and recommends links to bring priority pages closer to root.

Analyze the internal link depth report for {site_url} (CSV: url, crawl_depth, pagerank_score, organic_traffic, impressions). Identify: (1) high-value pages (top traffic or impressions) buried at crawl depth >3, (2) orphaned high-value pages at any depth, (3) pages with strong internal PageRank but low traffic (wasted equity). For each issue, recommend specific source pages and anchor text for new internal links to reduce depth...
contentinternal-linkslink-equity
Ranking v1.0

Knowledge Panel Gap Signal Fixer

Diagnoses missing or incorrect Knowledge Panel attributes and prescribes structured-data and off-site fixes.

Audit the Google Knowledge Panel for '{entity_name}' ({entity_type}: brand/person/place). Document: (1) attributes currently displayed vs. missing (founding date, description, social profiles, headquarters, etc.), (2) data source inferred for each displayed attribute (Wikidata, official site, news), (3) structured data gaps on {site_url}, and (4) off-site entity consolidation actions (Wikidata edits, press corrections)...
rankingknowledge-panelentity
Ranking v1.0

Local Pack Citation Gap Audit

Compares NAP citation consistency across directories for local pack ranking improvement.

Audit the local citation profile for '{business_name}' ({location}) against the top {num_competitors} local pack competitors. For each citation source (Google Business Profile, Yelp, Bing Places, Apple Maps, top {num_directories} niche directories): (1) verify NAP consistency (name, address, phone), (2) identify missing citations the competitors have, (3) flag citation inaccuracies, and (4) prioritize new citation sources by domain authority...
rankinglocal-packcitations
GEO v1.0

Multi-LLM Answer Gap Auditor

Compares answers across ChatGPT, Claude, and Perplexity to find brand or fact representation gaps.

Submit the following {question_list} to ChatGPT (GPT-4o), Claude (Sonnet), and Perplexity. For each question record: brand mentions, cited sources, factual claims about {brand_name}, and answer sentiment. Identify: (1) questions where the brand is absent from all LLMs, (2) factual inaccuracies, (3) competitor mentions displacing the brand, and (4) content gaps to address...
geomulti-llmbrand
Audit v1.0

Orphan Page Equity Reclaim Audit

Identifies orphaned indexed URLs and recommends internal linking or consolidation actions.

Given the following list of indexed URLs from {site_url} (from Google Search Console) and the crawled internal link graph (CSV: source_url, target_url), identify pages present in the index that receive zero internal links. For each orphan, classify by: content type, estimated traffic, and recommended action (link-in, consolidate, noindex)...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Question Expansion Harvester

Recursively expands People Also Ask questions for a seed topic to build a full intent tree.

Starting from the seed query '{seed_query}', systematically expand the People Also Ask question tree for the {industry} niche. For each PAA question, record: question text, inferred intent type, current answer source domain, and content format of the answer. Cluster questions into intent groups and identify the top 20 unanswered or weakly-answered questions where {site_url} could capture the PAA box...
rankingpaaintent
Content v1.0

Programmatic Content Template Planner

Designs a scalable programmatic content template with variable slots and quality guardrails.

Design a programmatic content template for {content_type} pages on {site_url} targeting the '{keyword_pattern}' keyword pattern (estimated {page_count} pages). The template must specify: (1) fixed vs. variable content sections, (2) minimum unique content requirements per page to avoid thin content, (3) required entities and schema types per page, (4) internal linking logic (hub page, related pages), and (5) quality threshold checklist for auto-publishing...
contentprogrammatictemplate
Technical v1.0

Schema JSON-LD Markup Generator

Generates valid JSON-LD schema markup for a specified page type and entity based on input data.

Generate a complete, valid JSON-LD schema block for a {schema_type} page on {site_url}. Input data: {entity_data}. Requirements: (1) include all required properties per schema.org and Google Rich Results guidelines, (2) include recommended properties that improve rich result eligibility, (3) nest related entity types (e.g., author Person, publisher Organization, breadcrumb BreadcrumbList), (4) validate against Google's Rich Results Test criteria. Output raw JSON-LD only...
technicalschemajson-ld
Technical v1.0

Server-Side Rendering SEO Decision

Evaluates a JavaScript app's rendering strategy and recommends SSR, SSG, or hybrid approaches.

Evaluate the rendering architecture of {site_url} built on {framework} (current strategy: {current_rendering_strategy}). Analyze: (1) which page types are crawled and indexed correctly vs. which rely on client-side rendering that Googlebot may not execute, (2) Time to First Byte and LCP impact of current strategy, (3) JavaScript bundle size vs. crawl render budget, (4) recommended rendering strategy per page type (SSR, SSG, ISR, CSR). Provide implementation steps for each recommendation...
technicalrenderingjavascript
Ranking v1.0

Shopping SERP Feed Data Optimizer

Audits a Google Merchant Center product feed for Shopping SERP ranking and impression optimization.

Audit the following Google Merchant Center feed sample for {site_url} (products: {product_list}). For each product, evaluate: (1) title keyword structure vs. Shopping SERP top performers, (2) missing required and recommended attributes (GTIN, MPN, product_type, color, size), (3) description keyword density and length, (4) image quality against Google guidelines, and (5) price competitiveness signal. Output a feed optimization table...
rankingshopping-serpfeed
Technical v1.0

XML Sitemap Index Structure Builder

Engineers a sitemap index file and child sitemap structure optimized for crawl efficiency.

Design the XML sitemap architecture for {site_url} with approximately {total_url_count} indexable URLs across content types: {content_type_list}. Specify: (1) sitemap index file structure with child sitemap filenames and scope, (2) URL allocation per child sitemap (max 50,000 per file), (3) priority and changefreq values by content type, (4) news sitemap if applicable, (5) image sitemap inclusion strategy. Output the sitemap index XML and one sample child sitemap XML...
technicalsitemapcrawl
GEO v1.0

AI Mode Passage Fit Scorer

Scores each passage on {url} for fit with Google AI Mode retrieval and outputs rewrite recommendations.

Act as a Google AI Mode optimization specialist. Segment the content of {url} into individual passages and score each on: query alignment, factual completeness, formatting clarity, and entity richness. Produce a passage-level scorecard and rewrite the three lowest-scoring passages to improve AI Mode retrieval fit...
geoai-modepassage-scoring
GEO v1.0

Brand Mention Gap Finder

Identifies topics and sources where {brand} has zero LLM mentions and prioritizes outreach targets.

You are a brand GEO analyst. Test {brand} against the query list {queries} across ChatGPT and Perplexity. Document every topic cluster where {brand} receives zero mentions, identify the sources that appear instead, and produce a prioritized list of publication targets and content angles to earn mention inclusion...
geobrand-mentionsgap-analysis
Audit v1.0

Broken Link Crawl Sweep

Sweeps {domain} crawl data for broken internal and external links and prioritizes fixes by page authority.

You are an SEO link auditor. Using the crawl export provided for {domain}, identify all internal and external links returning 4xx or 5xx status codes. Rank each broken link by the authority of the source page, suggest a replacement URL or removal action, and output results as a prioritized CSV...
auditbroken-linkscsv
GEO v1.0

ChatGPT Entity Citation Planner

Forecasts the likelihood of {brand} being cited by ChatGPT Browse and maps content gaps to improve odds.

Act as an AI citation analyst. Given the brand profile for {brand} and its top content URLs, forecast the probability of ChatGPT with browsing citing {brand} for queries in {topic_cluster}. Identify the three largest content or authority gaps blocking citation and provide a specific content action for each...
geochatgptcitations
Ranking v1.0

Cluster Opportunity Size Matrix

Scores topic clusters by traffic opportunity and ranking difficulty for {domain} in {niche}.

Act as an SEO strategist. Using the keyword data provided for {niche}, group keywords into topic clusters, then score each cluster on: total search volume, average keyword difficulty, {domain} current average position, and content gap size. Output a prioritized opportunity matrix sorted by expected incremental traffic gain...
rankingkeyword-clustersopportunity
Content v1.0

Content Gap Cluster Finder

Identifies topic sub-clusters covered by competitors but absent from {domain} and ranks them by opportunity.

Act as a content gap analyst. Compare the content inventory of {domain} against the top 3 competitors: {competitor_1}, {competitor_2}, {competitor_3}. Identify topic sub-clusters present on competitor sites but absent or thin on {domain}. Score each gap by estimated search volume and rank by traffic opportunity, outputting a prioritized content gap list...
contentcontent-gapcompetitor-analysis
Content v1.0

Content Refresh Traffic Brief

Generates a refresh brief for a decaying {url} targeting traffic recovery via updated content and signals.

Act as a content refresh strategist. Given the traffic decay data and current content of {url}, produce a refresh brief that includes: new facts or statistics to replace outdated claims, SERP intent realignment changes, structural updates to match current top-ranking formats, internal link additions, and updated meta title and description...
contentcontent-refreshtraffic-recovery
Audit v1.0

Core Web Vitals CrUX Deep Audit

Diagnoses CrUX field data failures for {url} and maps each metric to a root-cause fix.

Act as a Core Web Vitals performance engineer. Analyze the CrUX field data report for {url}. For each metric failing the Good threshold (LCP, INP, CLS), identify the most likely root cause using the page HTML/resource waterfall provided, and output a ranked fix list with expected metric improvement per fix...
auditcore-web-vitalsperformance
Content v1.0

E-E-A-T Author Bio Builder

Writes an E-E-A-T-optimized author bio for {author_name} tailored to {domain} and {topic_niche}.

You are an E-E-A-T content specialist. Using the background information provided for {author_name}, write a structured author bio optimized for E-E-A-T signals in {topic_niche}. Include: demonstrated first-hand experience, professional credentials, publication history, and a schema-ready JSON-LD Person markup block to accompany the bio on {domain}...
contente-e-a-tauthor
GEO v1.0

Entity Salience Content Brief

Builds a GEO content brief that increases entity salience for {brand} across AI language model responses.

Act as a GEO content strategist. Create a content brief for a {content_type} about {topic} designed to increase entity salience for {brand} in LLM training and retrieval contexts. Include required entities, co-occurrence terms, factual claims to include, and structural formatting recommendations...
geoentity-saliencecontent-brief
Content v1.0

FAQ Entity Block Generator

Generates entity-rich FAQ blocks with FAQPage schema for {topic} targeting PAA and AI Overview retrieval.

You are a content and schema specialist. For the topic {topic}, generate 8 FAQ pairs written to directly answer People Also Ask questions and AI Overview queries. Each answer should be 40–80 words, entity-rich, and factually specific. Output the FAQ content alongside complete FAQPage JSON-LD schema markup ready for implementation...
contentfaqschema
Ranking v1.0

Knowledge Panel Entity Gap Audit

Identifies missing entity signals blocking a Knowledge Panel for {brand} and outputs a structured fix plan.

You are a Knowledge Graph optimization specialist. Analyze the current entity signals for {brand}: Wikidata presence, Wikipedia article, structured data on {domain}, authoritative mentions, and Google Business Profile data. Identify which signals are missing or weak and produce a step-by-step plan to establish or strengthen the Knowledge Panel...
rankingknowledge-panelentity
Technical v1.0

LCP Resource Load Chain Audit

Traces the LCP resource load chain for {url} and outputs a prioritized list of optimizations to reduce LCP.

Act as a Core Web Vitals performance engineer. Using the WebPageTest waterfall and resource timing data for {url}, trace the full LCP resource discovery chain from initial HTML to final LCP element paint. Identify render-blocking resources, late-discovered images, and missing preload hints. Output a ranked fix list with estimated LCP reduction per action...
technicallcpperformance
GEO v1.0

LLM Recency Signal Content Plan

Creates a content freshness plan for {domain} to improve recency signals in LLM retrieval for {topic}.

Act as a GEO content strategist focused on recency optimization. For {domain} in the topic area of {topic}, design a content update and publication schedule that maximizes recency signals recognized by LLMs with web access. Include update frequency, timestamp best practices, freshness anchor phrases, and changelog schema markup recommendations...
georecencyfreshness
Audit v1.0

Log File Crawl Budget Analyzer

Analyzes server log data to identify crawl budget waste and Googlebot inefficiencies on {domain}.

You are an SEO log file analyst. Given the following server log excerpt for {domain}, identify which URL patterns consume the most Googlebot crawl budget, flag non-canonical or low-value pages being crawled, and recommend robots.txt or redirect changes to reclaim budget...
auditlog-filecrawl-budget
Audit v1.0

Mobile-First Indexing Gap Finder

Compares desktop vs. mobile-rendered HTML of {url} to surface mobile-first indexing content gaps.

You are a mobile-first indexing specialist. Compare the desktop HTML and mobile HTML snapshots of {url} provided below. Identify any content, structured data, internal links, or meta tags present on desktop but missing from mobile. Rank each gap by its likely impact on mobile-first indexing...
auditmobile-firstindexing
GEO v1.0

Multi-LLM Source Preference Audit

Compares which sources ChatGPT, Claude, and Perplexity prefer for {topic} queries and maps brand gaps.

You are a multi-LLM GEO analyst. For the query set {queries}, record which sources are cited by ChatGPT, Claude, and Perplexity respectively. Produce a source preference matrix, identify which competitor domains appear most consistently, and recommend content or authority actions for {brand} to enter the citation set...
geomulti-llmcitations
Ranking v1.0

News SERP Freshness Content Plan

Designs a publishing cadence and content format plan for {domain} to earn consistent news SERP inclusion.

You are a news SEO specialist. Analyze the news SERP results for {topic_cluster} over the past 30 days, identify the content formats, publication cadence, and structural signals (NewsArticle schema, bylines, timestamps) used by consistently appearing domains. Produce a freshness content plan for {domain} to achieve regular news SERP inclusion...
rankingnews-serpfreshness
Ranking v1.0

People Also Ask Intent Bridge

Maps PAA questions for {keyword} to existing {domain} content gaps and drafts concise answer blocks.

Act as a PAA optimization strategist. Extract all People Also Ask questions appearing for {keyword} in the US SERPs. Map each question to existing pages on {domain} that partially address it, identify gaps, and for each gap draft a 40–60 word direct answer block formatted for PAA extraction, with recommended placement on the page...
rankingpaacontent-gaps
Technical v1.0

Robots.txt Crawl Efficiency Optimizer

Rewrites {domain} robots.txt to optimize crawl efficiency without inadvertently blocking critical resources.

You are a technical SEO engineer. Review the current robots.txt for {domain} provided below. Identify: disallow rules blocking critical JS/CSS resources, missing disallows for low-value URL patterns, sitemap declaration issues, and crawl-delay misuse. Output a revised robots.txt with inline comments explaining each change and a risk assessment for each modification...
technicalrobots-txtcrawl
Ranking v1.0

SERP Intent Volatility Tracker

Tracks intent type shifts in SERP results for {keyword_set} over time and flags ranking risk signals.

Act as a SERP intelligence analyst. For each keyword in {keyword_set}, classify the dominant SERP intent (informational, navigational, commercial, transactional) and compare current results to {baseline_date} snapshots. Flag any keywords where intent type has shifted, explain the cause, and recommend content alignment changes...
rankingserp-intentvolatility
Technical v1.0

Sitemap Index Architecture Spec

Designs a scalable sitemap index architecture for {domain} segmented by content type and crawl priority.

Act as a technical SEO architect. Design a sitemap index structure for {domain} with the following requirements: separate child sitemaps by content type ({page_types}), enforce 50,000 URL and 50MB limits per sitemap file, implement lastmod dates accurately from CMS data, and add image/video sitemap extensions where applicable. Output the sitemap index XML and child sitemap templates...
technicalsitemaparchitecture
GEO v1.0

AI Mode Query Cluster Fit Audit

Identify which query clusters trigger AI Mode responses and score {brand}'s content fit.

Test the following {n} queries in Google AI Mode and record whether an AI-generated response appears, which sources are cited, and whether {brand} content is included. Score content fit per cluster and output a gap-priority action plan...
geoai-modecontent-fit
GEO v1.0

AI Overview Entity Depth Profiler

Assess how deeply a brand's entity signals appear in AI Overview responses for target queries.

For the following {n} queries relevant to {brand}, capture the current AI Overview text and identify where {brand} is mentioned, cited, or implied. Score entity depth on a 1–5 scale and recommend content changes to strengthen presence...
geoai-overviewentity
Content v1.0

Anchor Text Diversity Strategy Plan

Analyze anchor text profile and generate a balanced internal anchor diversification plan.

Audit the internal anchor text profile for {target_url} on {site} using the provided crawl export. Identify over-optimized exact-match anchors, underused semantic variants, and naked-URL opportunities. Output a per-linking-page anchor text rewrite plan...
contentanchor-textinternal-links
Technical v1.0

CDN Cache-Control SEO Header Audit

Audit CDN cache-control headers for SEO conflicts and recommend optimal header configurations.

Audit the response headers for the following {n} URLs on {site} fetched via {cdn_provider}. Identify Cache-Control, Surrogate-Control, and Vary header misconfigurations that could cause stale content delivery to Googlebot. Output corrected header directives per URL type...
technicalcdnheaders
Technical v1.0

Cloudflare Worker SEO Redirect Builder

Write a Cloudflare Worker script to handle large-scale SEO redirects at the edge.

Write a Cloudflare Worker script to implement the following redirect rules for {site}: {redirect_rules_list}. The script must: handle both exact and pattern-match redirects, preserve query strings where specified, return 301 status codes, and log matched rules for monitoring...
technicaledge-seocloudflare
Content v1.0

Content Brief Competitor Intent Match

Generate a content brief by reverse-engineering the top-ranking competitors' intent signals.

Analyze the top 5 ranking pages for '{target_keyword}' and extract: primary intent, subheading structure, content format, word count, entity mentions, and multimedia use. Use these signals to generate a detailed content brief for {site}...
contentbriefintent
Content v1.0

Content Decay Traffic Loss Recovery Plan

Diagnose why a page lost organic traffic and produce a structured refresh action plan.

Given the traffic history for {url} showing a {percent}% decline since {date}, identify the likely decay drivers: SERP layout changes, content staleness, competitor upgrades, or intent shift. Output a prioritized refresh plan with specific content edits...
contentcontent-decayrefresh
Content v1.0

Content Outline E-E-A-T Authority Builder

Structure a content outline with explicit E-E-A-T signals embedded at each section level.

Create a detailed content outline for '{topic}' that explicitly maps E-E-A-T signals at each section: author experience indicators, expertise cues, authoritativeness anchors (citations, data), and trustworthiness elements. Specify the content type and format for each section...
contente-e-a-toutline
Audit v1.0

CrUX Segment Deep Dive Audit

Break down Core Web Vitals CrUX data by device and connection segment to isolate failures.

Using the CrUX data export for {site}, segment LCP, INP, and CLS scores by device type and effective connection type. Identify which segments fall below 'Good' thresholds and output a root-cause hypothesis for each failing segment...
auditcore-web-vitalscrux
Audit v1.0

URL Parameter Duplicate Sweep

Detect duplicate content clusters generated by URL parameters and recommend canonicalization.

Given the crawl export for {site}, identify URL parameter combinations that produce near-duplicate page content. Group duplicates into clusters, specify a canonical target for each cluster, and flag any that conflict with existing canonical tags...
auditduplicatescanonical
Content v1.0

E-E-A-T Author Bio Signal Optimizer

Rewrite author bios and byline pages to maximize E-E-A-T signals for target topics.

Rewrite the author bio for {author_name} on {site} to maximize E-E-A-T signals for the topic area '{topic_area}'. Include: verifiable credentials, first-hand experience indicators, publication history, and links to authoritative third-party profiles...
contente-e-a-tauthor
Ranking v1.0

Featured Snippet Format Type Optimizer

Determine the winning snippet format for a keyword set and rewrite content to match.

For each keyword in {keyword_list}, identify the current featured snippet format (paragraph, list, table, video) and word count. Compare {site}'s existing content format against the winning format and output a per-keyword rewrite specification...
rankingfeatured-snippetformat
GEO v1.0

Generative SERP Passage Targeting Brief

Write a content brief optimized for passage-level retrieval in generative SERP features.

Create a passage-level content brief for the topic '{topic}' targeting generative SERP inclusion. Specify required subtopics, ideal answer formats (definition, steps, comparison), target passage length, and entity co-occurrence signals needed for {brand}'s page...
geogenerative-serppassage
Audit v1.0

Hreflang Return Tag Parity Check

Verify that every hreflang tag has a valid reciprocal return tag on the target page.

Analyze the hreflang implementation across {site} using the provided crawl export. For each hreflang annotation, confirm the corresponding return tag exists on the referenced locale URL. Output a table of broken pairs with corrective markup...
audithreflanginternational
Audit v1.0

Image SEO Full Signal Audit

Audit image alt text, file names, structured data, and lazy-load settings across key pages.

For the page set {url_list} on {site}, audit every image for: descriptive alt text, keyword-relevant file names, ImageObject schema presence, and lazy-load configuration. Output a per-image scorecard with prioritized fix recommendations...
auditimage-seostructured-data
Ranking v1.0

Image SERP Structured Data Gap Finder

Find missing structured data signals blocking images from ranking in image SERP features.

Audit image pages on {site} for the following image SERP signals: ImageObject schema, descriptive captions, alt text relevance, EXIF metadata, and page context quality. Output a gap table with the structured data additions most likely to improve image rankings...
rankingimage-serpstructured-data
Technical v1.0

INP Interaction Event Trace Optimizer

Trace high INP interaction events to their root cause and generate optimization tasks.

Analyze the WebPageTest or Chrome DevTools trace for {url} and identify all interaction events with INP contributions above 200ms. For each event, identify the responsible script, input delay, processing time, and presentation delay. Output a prioritized optimization task list...
technicalinpcore-web-vitals
Audit v1.0

Internal Link Depth Structure Audit

Assess click depth distribution of internal links and flag pages buried too deep.

Analyze the crawl data for {site} and produce a click-depth histogram for all indexed URLs. Flag any commercially important pages beyond depth {max_depth} and recommend link injection opportunities to surface them...
auditinternal-linksarchitecture
Audit v1.0

JS Content Visibility Render Audit

Compare rendered vs raw HTML to identify content hidden from crawlers by JavaScript.

Compare the raw HTML response and the fully rendered DOM for {url} using the provided Googlebot-agent snapshots. List every content element, link, or structured data block visible only post-render, and classify the SEO risk level for each...
auditjavascriptrendering
GEO v1.0

LLM Brand Mention Context Auditor

Analyze the sentiment and context in which LLMs mention a brand unprompted.

Prompt each of the following LLMs with queries related to {topic} without naming {brand}. Record every instance the brand is mentioned, classify the sentiment (positive/neutral/negative), and identify the contextual triggers driving each mention...
geobrand-mentionsentiment
GEO v1.0

LLM Recency Freshness Signal Optimizer

Identify content freshness signals that improve recency scoring in LLM source selection.

Audit the following {n} pages on {site} for LLM recency signals: last-modified dates, schema dateModified accuracy, inline date references, and citation of recent studies or statistics. Output a freshness upgrade plan ranked by estimated citation impact...
geofreshnessllm
GEO v1.0

Multi-LLM Source Coverage Matrix

Compare which sources each major LLM cites for a topic to find universal citation gaps.

Submit the query '{query}' to ChatGPT, Claude, Perplexity, and Gemini. Record cited sources, answer structure, and entity mentions for each. Build a cross-LLM source coverage matrix and highlight domains cited by 3+ models for {brand} benchmarking...
geomulti-llmcitation
Ranking v1.0

News SERP Freshness Authority Plan

Build a content and publishing strategy to improve inclusion in Google News SERP features.

Audit {site}'s current News SERP inclusion rate for topic {topic}. Analyze publishing velocity, article freshness signals, NewsArticle schema completeness, and Google News approval status. Output a 90-day plan to improve News SERP visibility...
rankingnews-serpfreshness
Audit v1.0

Orphan Page Internal Gap Audit

Find orphan pages with no internal links and estimate their lost equity impact.

Using the crawl export and sitemap for {site}, identify all URLs receiving zero internal links. For each orphan page, estimate traffic potential lost and recommend the top three link insertion points from existing content...
auditinternal-linksorphan
Ranking v1.0

PAA Intent Cluster Expander

Recursively expand People Also Ask results to map full intent cluster opportunity trees.

Starting with the seed query '{query}', recursively expand the People Also Ask results for three levels. Organize the resulting questions into intent clusters, estimate search volume tier for each cluster, and recommend content gaps for {site}...
rankingpaaintent-cluster
Content v1.0

Programmatic Content Schema Seed Template

Design a scalable content template with schema for programmatic page generation.

Design a programmatic content template for the page type '{page_type}' on {site}. Specify: dynamic content slots, static authority copy requirements, schema markup type and variables, internal link logic, and uniqueness rules to avoid thin-content penalties...
contentprogrammaticschema
Technical v1.0

Robots.txt Crawl Efficiency Architect

Redesign robots.txt rules to maximize crawl efficiency for a specific CMS and site structure.

Given the current robots.txt for {site} and the crawl waste report showing {wasted_urls} low-value URLs, rewrite the robots.txt to: block faceted parameter URLs, restrict crawl to priority templates, and add sitemap directives. Output the full revised file with inline comments...
technicalrobots-txtcrawl
Content v1.0

Schema-Rich How-To Content Writer

Draft how-to content structured for HowTo schema eligibility and featured snippet capture.

Write a how-to article for '{task}' optimized for HowTo rich results. Each step must be: action-oriented, under 140 characters for the step name, paired with an image alt text suggestion, and compiled into valid HowTo JSON-LD at the end of the draft...
contenthow-toschema
Technical v1.0

Security Headers CSP SEO Risk Audit

Audit Content Security Policy and other security headers for SEO-impacting misconfigurations.

Analyze the security response headers for {site} including CSP, X-Frame-Options, HSTS, and Permissions-Policy. Identify any directives that could block Googlebot from rendering JavaScript, loading resources, or following redirects. Output corrected header values with SEO impact notes...
technicalsecurity-headerscsp
Ranking v1.0

SERP Intent Depth Segment Audit

Classify the dominant and secondary intent for each keyword in a target set and map content gaps.

For each keyword in {keyword_list}, analyze the current top-10 SERP to classify primary intent (informational/navigational/commercial/transactional) and secondary intent signals. Map {site}'s current ranking pages against intent and flag mismatches...
rankingintentserp
Ranking v1.0

SERP Volatility Cause Signal Report

Correlate ranking volatility spikes with algorithm updates, competitor changes, or content edits.

Given the ranking history export for {site} over the period {date_range}, identify URLs with volatility spikes >5 positions. For each volatile URL, correlate the spike date with known algorithm updates, {site} content changes, and top-3 competitor movements...
rankingvolatilityalgorithm
Ranking v1.0

Shopping Feed Attribute Gap Optimizer

Identify product feed attribute gaps reducing visibility in Shopping SERP results.

Analyze the Google Merchant Center feed for {site} and identify products missing high-impact attributes: GTIN, product type, custom labels, and descriptive titles. Prioritize gaps by estimated impression uplift and output a feed update specification...
rankingshopping-serpfeed
Audit v1.0

Log File Anomaly Audit

Identify crawl anomalies and bot behavior patterns from raw server log data.

Analyze the following server log extract for {site}: flag unusual bot request spikes, status code distributions, and crawl gaps by section. Output a prioritized anomaly table with recommended fixes...
auditlog-filecrawl
GEO v1.0

Source Authority Signal Gap Model

Model which authority signals distinguish LLM-cited sources from uncited competitors.

Compare the top 10 domains cited by {llm} for topic {topic} against 10 uncited competitor domains. Analyze differences in: domain age, backlink profile, schema usage, topical depth, and E-E-A-T signals. Output a ranked list of gap signals for {brand} to close...
geosource-authorityllm
Content v1.0

Title Meta CTR Batch Rewrite Spec

Batch-rewrite title tags and meta descriptions to improve CTR using SERP position data.

Using the Search Console CTR data for {site}, identify the top 50 pages with above-average impressions but below-average CTR. For each page, rewrite the title tag and meta description using the current SERP snippet context, competitor titles, and power-word principles...
contentctrtitle-tag
Content v1.0

Topic Cluster Gap Priority Map

Find missing spoke pages in existing topic clusters and rank them by traffic opportunity.

Audit the existing content cluster for pillar topic '{pillar_topic}' on {site}. Identify missing spoke pages based on PAA data, competitor coverage, and keyword clustering. Rank each gap page by estimated traffic opportunity and internal link equity value...
contenttopic-clustergap
Technical v1.0

XML Sitemap Index Health Split Audit

Audit sitemap index structure for URL limits, crawl priority signals, and stale entries.

Audit the sitemap index and all child sitemaps for {site}. Check for: URLs exceeding the 50,000 limit per sitemap, lastmod accuracy vs. actual content changes, inclusion of noindex URLs, and missing high-value page templates. Output a restructured sitemap index plan...
technicalsitemapcrawl
GEO v1.0

AI Overview Passage Depth Optimizer

Rewrites content passages to maximize retrieval likelihood in Google AI Overview responses.

You are a GEO specialist. For the target query {query}, analyze the following page content {page_content} and identify the three passages most likely to be retrieved by Google's AI Overview. Rewrite each passage to be more self-contained, factually dense, and directly answering the query intent, then explain the structural change made...
geoai-overviewpassage-retrieval
GEO v1.0

AEO Topical Cluster Depth Planner

Plans topical depth expansions to satisfy AEO/GEO requirements for authoritative answer coverage.

For the core topic {core_topic}, generate a three-tier content depth plan: (1) foundational questions LLMs expect answered, (2) nuanced subtopic questions requiring expert coverage, and (3) emerging questions not yet well-covered online. For each tier, specify the recommended content format, target word count, and schema type to maximize answer engine visibility...
geoaeotopical-authority
GEO v1.0

Brand Mention Context Gap Brief

Identifies missing context around brand mentions that prevents LLMs from associating the brand correctly.

Audit the top 20 external pages that mention {brand_name} by scraping or reviewing {mention_urls}. For each mention, assess whether the surrounding context correctly conveys the brand's category, core value proposition, and key differentiators. Flag mentions with missing or misleading context and draft corrective outreach or PR content...
geobrand-mentionentity
Audit v1.0

Canonical Chain Conflict Resolver

Detects chained or conflicting canonical tags that confuse Googlebot about the preferred URL.

Given the crawl export {crawl_export} containing canonical tag values per URL, identify all instances of: (1) canonical chains (A → B → C), (2) self-referencing canonicals on non-indexable pages, and (3) conflicting canonical vs. redirect signals. For each issue type, list affected URLs and provide the corrected canonical directive...
auditcanonicalindexing
Content v1.0

Content Gap Cluster Opportunity Brief

Finds high-traffic content gaps within a topic cluster that competitors rank for but the site does not.

Using the keyword gap report {gap_report_csv} comparing {site_url} against competitors {competitor_list}, identify the top 10 keyword clusters where competitors rank in positions 1-10 but {site_url} has no ranking content. For each cluster, estimate traffic opportunity, recommended content type, and whether a new page or expansion of an existing page is more appropriate...
contentgap-analysiscluster
Audit v1.0

Core Web Vitals Template Audit

Diagnoses CWV failures by page template using CrUX field data to prioritize fixes.

Analyze the CrUX field data export {crux_export} and group URLs by page template type {template_list}. For each template, report the 75th-percentile LCP, INP, and CLS scores, flag those failing Core Web Vitals thresholds, and recommend the single highest-impact fix per failing template...
auditcore-web-vitalscrux
GEO v1.0

Claude Source Selection Pattern Audit

Reverse-engineers Claude's source selection preferences for a topic to inform GEO content strategy.

Submit the following 10 queries {query_list} to Claude and record all cited or paraphrased sources. Identify the common attributes of selected sources (domain type, content format, citation density, recency). Compare {brand_domain}'s content against these attributes and produce a Claude-specific GEO optimization brief...
geoclaudesource-preference
Audit v1.0

Faceted Nav Crawl Waste Detector

Identifies faceted navigation URL patterns causing crawl waste and recommends noindex or param rules.

Using the crawl log export {log_export} and site URL structure {url_patterns}, identify all parameter combinations generated by faceted navigation on {site_url}. Calculate the proportion of crawl budget consumed by faceted URLs with zero search demand. Recommend specific robots.txt disallow rules, noindex tags, or canonical strategies per parameter pattern...
auditfaceted-navcrawl-budget
Content v1.0

E-E-A-T Author Expertise Scorecard

Scores author E-E-A-T signals and prescribes bio, credential, and markup improvements.

Evaluate the E-E-A-T signals of author {author_name} on {site_url} across four dimensions: Experience (first-hand content evidence), Expertise (credentials, bylines), Authoritativeness (external citations, Wikipedia mentions), and Trustworthiness (author page completeness, Person schema). Score each 1-5, identify the weakest areas, and provide specific copy and markup fixes...
contente-e-a-tauthor
GEO v1.0

GEO Entity Prominence Signal Builder

Builds an entity prominence plan to increase a brand's salience score in LLM training corpora.

For {brand_name}, map all current entity associations using available Knowledge Graph data, Wikipedia, and Wikidata. Score each association by prominence and accuracy. Identify three high-authority publication targets where new mentions would most increase entity salience, and draft the recommended entity description for each placement...
geoentityprominence
Audit v1.0

Image SEO Alt Metadata Audit

Audits image alt text, filenames, and structured data across a URL set for SEO completeness.

Review the image SEO data export {image_audit_csv} containing URL, image src, alt text, filename, title attribute, and surrounding context. Flag images with missing alt text, keyword-empty filenames, oversized file sizes, or absent structured data. Prioritize fixes by traffic potential of the parent page...
auditimage-seometadata
GEO v1.0

LLM Source Freshness Gap Audit

Detects how content recency affects LLM citation preference and flags stale pages losing visibility.

For the topic cluster {topic_cluster}, compare the publication and last-modified dates of pages on {brand_domain} against the dates of content cited by {llm_name} for related queries. Identify pages where staleness may be suppressing citation frequency and recommend a content refresh schedule with expected GEO impact...
geofreshnesscitation
Audit v1.0

Log File Bot Segment Audit

Segments server log data by bot type to identify crawl inefficiencies and wasted budget.

Analyze the following server log extract {log_data} and segment all requests by bot user-agent (Googlebot, Bingbot, GPTBot, etc.). For each segment, calculate crawl frequency, status code distribution, and URL path patterns, then flag any crawl budget waste or anomalies...
auditlog-filecrawl-budget
GEO v1.0

Multi-LLM Answer Gap Finder

Compares answers from multiple LLMs for a query to identify brand visibility gaps across models.

Submit the query {query} to ChatGPT, Claude, Gemini, and Perplexity. Record whether {brand_name} is mentioned, in what context, and with what sentiment in each response. Produce a gap matrix showing which models omit the brand, hypothesize why, and recommend content or entity signal changes to improve presence in the weakest model...
geomulti-llmbrand-visibility
Audit v1.0

Orphan Page Internal Link Audit

Detects orphaned pages with no internal links and recommends link insertion opportunities.

Given the crawl export {crawl_csv} and internal link graph {link_graph_csv}, identify all URLs with zero inbound internal links. For each orphan, suggest three contextually relevant existing pages that should link to it, propose anchor text, and estimate the crawl depth impact of adding those links...
auditinternal-linksorphan
Content v1.0

Programmatic SEO Template Content Audit

Audits programmatic page templates for thin content signals and prescribes differentiation strategies.

Review the programmatic page template {template_html} used to generate {page_count} pages on {site_url}. Identify thin content signals (duplicate boilerplate ratio, low unique word count, missing entity-specific content). For each signal, recommend a dynamic content module or data enrichment strategy that adds unique value per page without manual effort...
contentprogrammatic-seothin-content
Audit v1.0

Redirect Chain Impact Sweep

Maps multi-hop redirect chains and quantifies PageRank dilution and crawl cost per chain.

Using the redirect data {redirect_export}, identify all chains longer than one hop. For each chain, list the full hop sequence, HTTP status codes, estimated PageRank dilution percentage, crawl cost, and recommended consolidation action (direct 301, canonical, or removal)...
auditredirectscrawl-budget
Content v1.0

Title Meta Bulk Rewrite Brief

Batch-rewrites title tags and meta descriptions to improve CTR using SERP intent signals.

For the following list of URLs and their current title tags and meta descriptions {title_meta_csv}, rewrite each to: (1) front-load the primary keyword, (2) include a power word or emotional trigger, (3) stay within 60 characters (title) and 155 characters (meta), and (4) match the dominant SERP intent for {target_keyword}. Output as a CSV with columns: URL, new title, new meta description, character counts...
contenttitle-tagctr
Ranking v1.0

Video SERP Schema Opportunity Audit

Identifies video content missing VideoObject schema needed to appear in video SERP carousels.

Review the video content inventory at {site_url} using the URL list {video_urls}. For each video page, check for VideoObject schema presence, required properties (name, description, thumbnailUrl, uploadDate, duration), and Video Sitemap submission. Produce a fix table with missing properties and ready-to-paste JSON-LD for each page...
rankingvideo-serpschema
Technical v1.0

XML Sitemap Index Split Builder

Designs a segmented XML sitemap index structure for large sites to optimize crawl prioritization.

Design an XML sitemap index architecture for {site_url} with approximately {page_count} indexable pages. Segment sitemaps by content type {content_types}, priority tier, and update frequency. Specify the filename convention, URL count per sitemap file, lastmod update logic, and changefreq values. Output the sitemap index XML and one example child sitemap XML...
technicalsitemapcrawl
GEO v2.0

AI Overview Brief

Draft a content brief optimized for appearing in Google's AI Overviews for a target query.

Create a content brief targeting the query "{query}" with the goal of being cited in Google's AI Overview...
ai-overviewbrief
Content v4.1

Content Gap Analysis

Compare your content coverage against top-ranking competitors for a topic cluster and find gaps.

Compare the content on {your_url} with the top 5 ranking pages for "{topic}". Identify subtopics...
gapcompetitor
GEO v3.2

GEO Citation Audit

Analyze which domains LLMs cite for a given query and score your visibility across models.

You are an SEO analyst. Given the query "{query}", list every domain that would be cited by major AI assistants...
multi-modelcsv
Audit v2.2

Internal Link Audit

Evaluate the internal linking structure of a site section and suggest improvements for link equity flow.

Analyze the internal linking structure of {url_section}. Identify orphan pages, over-linked hubs...
linksstructure
Ranking v3.0

Keyword Clustering

Group a list of keywords into topically coherent clusters based on SERP overlap and semantic similarity.

Given the following list of keywords, group them into clusters where keywords share semantic meaning...
clusteringtopics
Technical v1.3

Schema Markup Generator

Generate JSON-LD structured data for any page type — article, product, FAQ, how-to, or local business.

Generate valid JSON-LD schema markup for a {page_type} page with the following details: title, desc...
schemajson-ld
Ranking v1.5

SERP Intent Classifier

Classify the search intent behind a keyword — informational, transactional, navigational, or commercial.

Given the keyword "{keyword}", analyze the top 10 SERP results and classify the dominant intent...
intentserp
Audit v2.8

Technical SEO Checklist

Generate a full technical audit checklist for any URL — crawlability, schema, Core Web Vitals, and indexing.

Audit the following URL for technical SEO issues. Check: robots.txt, sitemap, canonical tags, hreflang...
auditchecklist
Content v1.8

Title & Meta Rewriter

Rewrite page titles and meta descriptions to maximize CTR while preserving keyword targeting.

Rewrite the title tag and meta description for the page at {url}. Current title: "{title}". Target...
ctrmeta
Content v1.0

About Page Rewriter

Rewrite an About page for E-E-A-T signals + brand differentiation.

For About page {url}, rewrite: founding story, team credentials (with photos + LinkedIn), differentiation, social proof, transparency (Contact/Editorial). Add Organization schema.
abouteeat
GEO v1.0

AI Mode Visibility Audit

Specifically audit visibility in Google's AI Mode (vs traditional SERP).

For query set {query_list}, capture AI Mode responses. Report: which sources cited, citation rank, response length. Compare AI Mode visibility vs classic-SERP rank for same queries.
ai-modegoogle
GEO v1.0

AI Overview Competitor Map

For target queries triggering AIO, map which competitors get cited and why.

For query set {query_list} (triggers AIO), map cited competitors per query. For each competitor: citation frequency, what they're cited for, their winning content pattern.
competitorai-overview
GEO v1.0

AI Overview Content Brief

Build a content brief specifically optimized for AI Overview citation.

For target query {query} (triggers AIO), write a content brief: title, H1, FAQ block, structured-data plan, citation-friendly phrasing patterns, internal link plan.
ai-overviewbrief
GEO v1.0

AI Overview FAQ Generator

Generate the FAQ block most likely to win AI Overview citations.

For URL {url} targeting query {query}, generate 5-8 FAQ items most likely to be cited in AIO. Use PAA, common follow-ups, and competitor FAQs as input.
faqai-overview
GEO v1.0

AI Overview Ranking Factors

For a query that triggers AI Overview, reverse-engineer why the chosen sources were selected.

For query {query} (triggers AI Overview), analyze the 3-5 sources Google chose. Hypothesize: authority signal, freshness signal, structured-data signal, intent match.
ai-overviewserp
GEO v1.0

AI Search Query Rewriter

Generate the query rewrites LLMs are likely to produce for a target user intent.

For user intent {intent}, generate the 8-12 query rewrites a query-rewriter in a retrieval pipeline (Perplexity-style) is likely to fan out to.
query-rewriteretrieval
GEO v1.0

AI Search Audit Report Builder

Generate a stakeholder-ready audit report from a GEO Trace CSV.

From GEO Trace CSV at {csv_path} for {domain}, build a stakeholder report: executive summary, top 3 wins, top 3 gaps, recommended next steps, projected impact.
reportstakeholder
GEO v1.0

AI Search Authority Builder

Plan to build domain authority specifically in the eyes of LLMs (vs Google).

For domain {domain}, propose a 90-day plan to lift LLM-authority. Tactics: Wikipedia entity work, .gov/.edu citations, expert byline placement, structured-data depth.
authorityplan
GEO v1.0

AI Search Competitive Analysis

Map a competitor's LLM citation footprint and identify their winning content patterns.

For competitor {competitor}, analyze their LLM citation footprint across 14 engines. Identify top-cited URLs, common content patterns, and the queries they own.
competitiveanalysis
GEO v1.0

AI Search Intent Classifier

Classify whether a query is more likely to be answered by AI search vs classic search.

For query {query}, classify: pure-info / commercial / transactional / navigational. Score AI-search-suitability (0-10). Recommend AI-vs-classic optimization weighting.
intentai-search
GEO v1.0

AI Search Persona Builder

Build a persona of how a typical user uses AI search vs classic search for a topic.

For topic {topic}, build an AI-search user persona: typical query phrasings, follow-up patterns, source-trust signals they react to. Compare to classic-search persona.
personaux
GEO v1.0

AI Search Ranking Signal Audit

Audit a domain across the ranking signals LLMs appear to weight (vs Google).

Audit {domain} on the LLM-ranking-signal stack: structured data depth, entity coverage, fresh-claim density, citation-friendly phrasing, authoritative outbound links.
signalsranking
GEO v1.0

AI Search Recency Signal Optimizer

Audit and optimize a page's recency signals for AI search ranking.

For URL {url}, audit recency signals: visible "Updated" date, lastmod in sitemap, dateModified in schema, freshness of cited stats. Recommend updates.
recencyfreshness
GEO v1.0

AI Snippet Optimizer

Rewrite the first 200 chars of a page to be the AI-snippet for a target query.

For URL {url} targeting query {query}, rewrite the opening 200 chars to be: declarative answer, specific number/fact, no preamble. Show 3 variants.
snippetrewrite
Ranking v1.0

Algorithm Update Impact Analyzer

Analyze a domain's traffic delta around a confirmed Google algorithm update.

For {domain} around algorithm update on {update_date}, compute traffic delta by page template, query cluster, and SERP feature. Identify winning and losing patterns.
algo-updateimpact
Audit v1.0

AMP Page Audit

Audit AMP page validity, canonical pairing with non-AMP, and feature parity.

Audit AMP pages on {domain}. Report: AMP validation errors, canonical pairing with non-AMP version, feature parity (CTAs, schema, analytics) with non-AMP.
ampmobile
Technical v1.0

AMP Page Generator

Generate an AMP version of a page from the canonical HTML.

For canonical page {url}, generate AMP version: stripped JS, AMP components for media, schema parity, canonical pairing tags, AMP validation pre-check.
ampmobile
Audit v1.0

Anchor Text Distribution Audit

Analyze internal anchor text distribution per target page; flag over-optimization or generic-only.

For target pages {url_set}, report anchor text distribution from internal links. Flag: over-optimized (>40% exact match), generic-only ("click here" >60%), or missing entirely.
anchor-textinternal-links
Content v1.0

Anchor Text Recommender

For an internal link, recommend anchor text that's descriptive without over-optimizing.

For internal link from {source_url} to {target_url}, recommend 5 anchor text variants: descriptive, natural, not exact-match-stuffed. Show context surrounding text.
anchorinternal-links
Ranking v1.0

App Pack Optimization

Optimize an app for the App Pack SERP feature.

For app {app_name} on platforms {platforms}, audit App Pack visibility for target queries. Recommend: app-store listing, schema, deep-link strategy.
app-packmobile
Content v1.0

Article Expansion Brief

Brief for expanding a short article into a comprehensive one without dilution.

For thin article {url}, plan expansion: 3-5 new sections, supporting data sources, internal links to add, schema enhancements. Target 2-3× word count without filler.
expansionthin-content
Audit v1.0

Blog Content Inventory Audit

Inventory blog posts by traffic, freshness, engagement; recommend refresh/merge/prune per post.

Inventory blog posts on {domain}. For each: traffic trend, last-update date, engagement score. Classify: keep/refresh/merge/prune with reason.
bloginventory
Content v1.0

Blog Tone & Style Guide

Build a blog tone/style guide from a sample of existing posts.

From 10 sample posts on {domain}, derive style guide: voice attributes, sentence rhythm rules, vocabulary do/don't, headline patterns, image style notes.
style-guidetone
GEO v1.0

Brand Mention Diagnostics

Detect how a brand is mentioned (positive/neutral/inaccurate) across LLM responses.

For brand {brand}, run 20 brand-adjacent queries through 5 LLMs. For each mention: tone (positive/neutral/negative), accuracy, source it came from.
brandmentions
Content v1.0

Brand Voice Analyzer

Analyze brand voice consistency across owned content surfaces.

For brand {brand} across content surfaces (website, blog, email, social), score voice consistency. Flag drift per surface. Recommend alignment checklist.
voiceconsistency
Ranking v1.0

Branded vs Non-Branded Splitter

Split traffic and rank data into branded vs non-branded for clearer reporting.

For {domain}, classify GSC queries as branded or non-branded (brand match patterns). Report traffic, impressions, CTR split. Flag query patterns to investigate.
brandedsegmentation
Ranking v1.0

Breadcrumb SERP Optimizer

Optimize breadcrumbs to display correctly in SERP.

For URL {url}, audit BreadcrumbList schema and visible breadcrumbs. Fix mismatches; recommend changes to display breadcrumbs vs URL in SERP.
breadcrumbsserp
Audit v1.0

Broken Internal Link Sweep

Find internal links resolving to 4xx/5xx, redirect chains, or pages with noindex.

Crawl {domain} and report internal links pointing to 4xx, 5xx, redirect chains, or noindex pages. Group by source-page hub for batched fixing.
linksbroken
Content v1.0

Buyer's Guide Outline

Outline a buyer's guide: criteria, comparison frame, top picks, decision aid.

For product category {category}, outline buyer's guide: decision criteria list, top picks per use-case, comparison table, when to pick what, expert quotes.
buyers-guidecommercial
Audit v1.0

Canonical Tag Audit

Find pages with conflicting, missing, or self-defeating canonical signals.

Audit canonical tags on {url_set}. Identify canonicals pointing to noindex pages, redirect chains, off-site URLs, or contradicting HTTP headers.
canonicalduplication
Technical v1.0

Canonical URL Strategy

Define a canonical URL strategy for a site with parameters, faceted nav, and pagination.

For {domain}, define canonical strategy: parameter handling, faceted nav canonicals, pagination canonicals (self vs view-all), tracking-param stripping rules.
canonicalstrategy
Content v1.0

Case Study Brief

Brief a case study: customer setup, challenge, solution, results, quotable lines.

For customer {customer}, brief case study: setup, challenge, solution, results with numbers, pull-quote opportunities, supporting visuals, distribution plan.
case-studysocial-proof
Content v1.0

Category Page Copy Brief

Brief category page copy that ranks without crowding the product grid.

For category page {url}, brief copy: top-of-page intro (50 words), bottom-of-page expansion (300-500 words), FAQ, breadcrumb schema, sub-category links.
categoryecommerce
Audit v1.0

CDN SEO Configuration Audit

Verify CDN config preserves correct headers, redirects, and cache behavior for SEO.

Audit CDN config for {domain}. Check: User-Agent passthrough, redirect handling, cache headers for HTML vs assets, country-routing behavior, robots.txt edge handling.
cdnedge
GEO v1.0

Citation Context Analyzer

Analyze the sentence-level context of how a domain is cited (claim type, framing).

For domain {domain}, capture 50 citation contexts from LLM responses. Categorize: claim type (factual/opinion/example), framing (positive/neutral/qualified), claim novelty.
contextcitations
GEO v1.0

ChatGPT Visibility Tracker

Track which domains appear in ChatGPT browse responses for a query set over time.

For queries {query_set}, capture ChatGPT browse responses weekly. Track domain citation rank week-over-week. Flag risers, fallers, and new entrants.
chatgpttracking
GEO v1.0

Citation Drift Tracker

Track citation stability for a domain over time across LLM engines.

For domain {domain} and query set {query_list}, capture citation snapshot weekly. Compute drift: % of top-3 citations that change week-over-week per engine.
drifttracking
GEO v1.0

Citation Forecast Brief

Predict which planned content pieces are most likely to win citations before publishing.

For planned content pieces {brief_list}, predict citation probability per piece across 14 engines. Rank by predicted lift; recommend top 3 to publish first.
forecastprioritization
GEO v1.0

Citation Rate Forecaster (Pre-Publish)

Forecast the per-engine citation rate for a planned page before writing it.

For planned page with topic {topic} and target query {query}, forecast citation rate across 14 engines. Recommend content-shape tweaks that lift the forecast.
forecastpre-publish
GEO v1.0

Claude Citation Pattern Detector

Analyze what types of sources Claude with web access prefers to cite.

Run queries {query_set} through Claude with web access. Categorize cited sources by type (publisher, doc, forum, .gov, .edu). Report the type distribution.
claudecitations
Technical v1.0

Cloudflare Worker SEO Rules

Write a Cloudflare Worker for SEO concerns: redirects, header injection, A/B test bot handling.

For {domain} on Cloudflare, write Worker for: edge 301 redirects from {redirect_list}, security header injection, bot detection routing, AB-test cookie handling.
cloudflareworkers
Ranking v1.0

Cluster Opportunity Sizer

Size the traffic opportunity of a topic cluster before committing to build it.

For topic cluster {topic}, estimate: total addressable monthly search volume, current ranking ceiling (top-10 capture), realistic 6-month capture rate, traffic estimate.
clustersizing
Content v1.0

Comparison Post Outline

Outline an "X vs Y" comparison post with comparison table, intent coverage, and conclusion.

For comparison {x} vs {y}, outline post: intent of likely searchers, comparison table fields, sections per criterion, "which to choose" decision tree, FAQ.
comparisonoutline
Ranking v1.0

Comparison Query Optimizer

Optimize for "X vs Y" comparison queries the brand should win.

For brand {brand}, identify "X vs Y" queries where brand is X or Y. Audit current ranking. Recommend page format (table-heavy, schema-rich) per query.
comparisonversus
Ranking v1.0

Competitor Gap Analyzer

Identify keywords competitors rank for and you don't, ranked by opportunity.

For {domain} vs competitors {competitor_set}, identify keywords where competitors rank top-10 and {domain} doesn't rank top-50. Rank by volume × intent fit.
competitivegap
Content v1.0

Content Audit Report

Generate a stakeholder content audit report from a content inventory.

For content inventory at {csv_path}, build audit report: keep/refresh/merge/prune classification per post, traffic at risk, refresh-first list, executive summary.
auditreport
Content v1.0

Content Brief Generator

Generate a full content brief for a target query: structure, must-cover, intent, tone.

For query {query} on {domain}, generate brief: H1, H2 structure, must-cover entities, target word count, tone, schema plan, internal link plan, success metric.
briefplanning
Content v1.0

Content Depth Scorer

Score content depth vs top-ranking competitors for the same query.

For {url} on query {query}, score depth vs top-5 ranking pages: subtopic coverage %, unique angles, supporting data, multimedia richness. Recommend depth lifts.
depthscoring
Content v1.0

Content Gap Mapper

Map content gaps vs competitors as a query-by-query matrix.

For {domain} vs competitors {competitor_set} on topic {topic}, map content coverage. Output: matrix of queries × competitors with rank cells. Mark {domain} gaps.
gapmapping
Content v1.0

Content Refresh Prioritizer

Rank existing posts by refresh ROI: traffic decay × competitive risk × refresh cost.

For blog at {domain}, rank posts by refresh ROI: traffic decay slope, ranking-decline risk, refresh effort. Output top-20 with specific refresh action per post.
refreshprioritization
Content v1.0

Content Style Checker

Check a draft against a style guide and flag deviations.

For draft at {url} and style guide at {guide_url}, check: voice match, banned-word use, sentence-length distribution, heading-style compliance. Output edit list.
styleqa
Ranking v1.0

Core Update Recovery Brief

For a site impacted by a core update, build a recovery brief.

For {domain} impacted by core update on {update_date} (traffic -{pct}%), build recovery brief: likely cause, E-E-A-T fixes, content-quality fixes, link-profile fixes.
core-updaterecovery
Audit v1.0

Core Web Vitals Audit

Diagnose LCP, INP, and CLS issues across a site with one fix to ship first per page.

Audit {url} for Core Web Vitals. For each of LCP, INP, CLS: current value, target, top 3 contributing factors, and the single most impactful fix to ship first.
cwvperformance
Audit v1.0

Crawl Budget Analysis

Estimate where Googlebot is spending crawl budget vs where it should be spending it.

Analyze log file at {log_path}. Report crawl-frequency distribution by URL pattern, top wasted crawl on low-value paths, and underserved high-value paths.
crawl-budgetlog-analysis
GEO v1.0

Cross-Engine Rank Comparator

Compare citation rank for the same domain across all 14 LLM engines for a query.

For domain {domain} and query {query}, report citation rank across 14 LLMs. Identify engine outliers (very high or very low rank vs the rest) and hypothesize why.
cross-enginerank
Technical v1.0

CSP for SEO

Design Content Security Policy that doesn't break analytics, schema validators, or third-party SEO tools.

For {domain}, design CSP allowing: GTM/analytics scripts, schema-validator embeds, social-preview crawlers, common third-party SEO tools (GSC, Bing WMT).
cspsecurity
Content v1.0

CTA Copywriter

Generate 8 CTA variants for a page based on intent and brand tone.

For URL {url} with intent {intent} and brand tone {tone}, generate 8 CTA variants. Score predicted click-rate vs current. Recommend top 3 to test.
ctacopy
Ranking v1.0

Title/Meta CTR Optimizer

Generate title and meta variants that maximize CTR for a target query.

For URL {url} targeting query {query} with current CTR {ctr}%, generate 5 title + meta variants. Score predicted CTR lift. Recommend test order.
ctrtitles
Audit v1.0

Duplicate Content Scanner

Find near-duplicate pages (>80% similarity) within a domain and the canonical strategy for each cluster.

Cluster pages on {domain} by content similarity. For each cluster of >80% similarity: list URLs, recommend canonical winner, flag whether canonicals/redirects are needed.
duplicationcanonical
Ranking v1.0

E-E-A-T Signals Auditor

Audit E-E-A-T signals across a domain: bylines, expert credentials, citations, transparency.

Audit E-E-A-T on {domain}. Per content category: byline quality, author bio depth, expert credentials, citation density, transparency (About/Contact/Editorial policy).
eatauthority
Audit v1.0

E-commerce Site Audit

Audit category, product, and checkout pages for SEO-critical issues at scale.

Audit e-commerce site {domain}. For category/product/checkout templates: schema completeness, canonical strategy for variants, OOS page handling, faceted nav.
ecommercetemplates
Technical v1.0

Edge SEO Function Spec

Specify an edge function for canonical injection, redirect handling, or schema injection.

For {domain}, spec edge function: trigger conditions, transformations (header inject / redirect / body modify), rollback strategy, performance budget.
edgefunctions
Content v1.0

E-E-A-T Scorer

Score a page across Experience, Expertise, Authoritativeness, Trustworthiness signals.

Score {url} on E-E-A-T (0-10 each). For each axis: evidence on-page, gap vs top-ranking competitor, smallest change with biggest score lift.
eeatquality
GEO v1.0

Entity Association Mapper

For a brand, map which entities (people, products, topics) it's associated with in LLM responses.

For brand {brand}, query "what is {brand}?", "who founded {brand}?", "{brand} alternatives" across 5 LLMs. Map associated entities and confidence of association.
entitybrand
Audit v1.0

Faceted Nav SEO Audit

Audit faceted navigation for crawl traps, duplicate content, and canonical leakage.

Audit faceted nav on {category_url}. For each facet combo type: crawlable/disallowed, canonical target, noindex flag, intent value (high/low). Recommend handling.
facetsecommerce
Content v1.0

FAQ Section Generator

Generate a high-citation-potential FAQ section for a page.

For URL {url} on query {query}, generate 6-10 FAQs from PAA + sales-log mining + Reddit threads. Format with FAQ schema. Concise direct answers, no fluff.
faqpaa
GEO v1.0

Featured Citation Optimizer

Rewrite an existing page to maximize odds of being the featured citation in AI responses.

For URL {url} targeting query {query}, propose rewrites: opening paragraph, structured-data additions, factual-claim sourcing, length adjustments. Show before/after.
rewritefeatured
Ranking v1.0

Featured Image Optimizer

Optimize a page's featured image to win the SERP image thumbnail spot.

For URL {url} targeting query {query}, audit featured image. Recommend: dimensions, aspect ratio, schema fields, file name, image-pack capture potential.
featured-imagethumbnail
Ranking v1.0

Featured Snippet Targeter

For a target query, structure content to maximize featured-snippet capture odds.

For query {query}, identify current featured-snippet format (paragraph/list/table). Generate content matching that format, targeting first-position capture.
featured-snippetpaa
GEO v1.0

Generative Answer Optimization

Optimize a page to be the source quoted (not just cited) in generative answers.

For URL {url} and query {query}, identify the answer-snippet a generative engine would extract. Rewrite to be more quotable (specific, declarative, sub-200 chars).
snippetquotability
GEO v1.0

Generative Engine Optimization Plan

Build a 90-day GEO plan for a domain across all 14 LLM engines.

Build a 90-day GEO plan for {domain}. Output: weeks 1-2 audit, weeks 3-6 content interventions, weeks 7-9 schema/entity work, weeks 10-12 measurement.
plan90-day
GEO v1.0

Generative SERP Feature Targeting

Identify which generative SERP features a query triggers and how to target each.

For query {query}, identify all generative SERP features (AIO, People Also Ask, Featured Snippet, Knowledge Panel). For each: capture tactics tailored to that feature.
generative-serpfeatures
GEO v1.0

GEO Content Gap Analysis

Find queries where competitors are cited in AI engines but you are not.

For query set {query_list} relevant to {domain}, identify queries where {competitor_set} are cited in AI engines and {domain} is not. Rank by query volume × commercial intent.
gap-analysiscompetitive
GEO v1.0

GEO Keyword Research

Find queries that are well-suited for GEO optimization (vs classic SEO).

For topic {topic} on {domain}, find queries where GEO has more upside than classic SEO. Criteria: AI-search frequency, classic-SERP saturation, intent alignment.
keyword-researchgeo
Content v1.0

Glossary Entry Generator

Generate glossary entries optimized for both rich-result eligibility and AI citation.

For term {term}, generate glossary entry: 60-char definition, expanded explanation, related terms, DefinedTerm schema, internal links to related pages.
glossarydefinitions
Content v1.0

Headline Rewriter

Rewrite a headline for emotional pull + keyword retention + CTR.

For headline "{headline}" on URL {url}, generate 8 rewrites balancing: emotional pull, target-keyword retention, length (under 60 chars), SERP differentiation.
headlinesctr
Ranking v1.0

Helpful Content Review

Review pages against Google's Helpful Content guidelines and flag risk.

Review {url_set} against Helpful Content guidelines. For each: people-first score, first-hand-experience presence, AI-generated risk, satisfaction signal alignment.
helpful-contentreview
Content v1.0

Hero Copy Generator

Generate hero-section copy variants (h1 + sub + primary CTA).

For page {url} targeting {audience} for {goal}, generate 5 hero copy sets (h1, sub, primary CTA). Score each on clarity, differentiation, scan-readability.
herocopy
Content v1.0

How-To Content Brief

Brief a how-to article with step structure, tools list, time estimate, HowTo schema.

For task {task}, brief how-to article: step-by-step list, tools/materials, time estimate, HowTo schema fields, common-mistakes section, before/after photos plan.
how-tobrief
Audit v1.0

Hreflang Configuration Audit

Verify hreflang tag completeness, return-tag reciprocity, and language-region pairing.

Audit hreflang on {url_set}. Flag missing return tags, x-default omissions, invalid language-region codes, and self-referential gaps.
intlhreflang
Technical v1.0

Hreflang Tag Generator

Generate hreflang tags for a multi-locale URL set with correct return-tag pairing.

For URL set {url_locale_map}, generate hreflang tags: link-element format, x-default selection, return-tag pairing matrix. Output HTML head snippet per URL.
hreflangintl
Technical v1.0

HSTS Strategy

Plan HSTS rollout with preload-list eligibility.

For {domain}, plan HSTS rollout: max-age progression (1 day → 1 week → 6 months → 2 years), includeSubDomains gate, preload-list submission criteria.
hstssecurity
Technical v1.0

htaccess Rewrites Generator

Generate .htaccess rewrites for common SEO patterns (trailing slash, www, https, etc).

For {domain}, generate .htaccess: force HTTPS, force trailing-slash policy, www handling, custom 301s from {redirect_list}, secure headers.
htaccessapache
Audit v1.0

HTTPS Migration Verifier

Verify a HTTP→HTTPS migration is complete with no mixed content, broken redirects, or canonical loss.

Verify HTTPS migration of {domain}. Check: HTTP→HTTPS 301s site-wide, mixed-content warnings, canonical updates, hreflang updates, sitemap protocol, internal links protocol.
httpsmigration
Technical v1.0

Image Alt Text Generator

Generate descriptive alt text for an image set without keyword stuffing.

For image set at {image_dir} on URL {url}, generate alt text: describes image content + relates to page topic + under 125 chars + no "image of" prefixes.
alt-textaccessibility
Audit v1.0

Image SEO Audit

Audit alt text quality, file sizes, dimensions, lazy-load behavior, and indexability.

Audit images on {url}. For each: alt text quality (0/poor/good), file size vs displayed size, lazy-load tag, srcset coverage, indexability via image sitemap.
imagesalt-text
Ranking v1.0

Image SERP Analyzer

Analyze image SERP for a query and identify image SEO opportunities.

For query {query}, capture top 20 image-SERP results. Report: image dimensions, file types, source domains, alt-text patterns, surrounding-text overlap with query.
image-serpvisibility
Audit v1.0

Index Bloat Detector

Find indexed URLs that should not be indexed — faceted nav, internal search, parameter explosions.

Identify indexed URLs at {domain} matching patterns: faceted nav, internal search results, session-id params, sort-order variants. Recommend canonical / noindex / disallow per pattern.
bloatindexing
Content v1.0

Content Interlinking Map

Map internal links across a content cluster and identify missing connections.

For content cluster {cluster_urls}, map current internal links. Identify missing high-value connections. Output edit-list per page with anchor text.
interlinkingcluster
Content v1.0

Internal Link Recommender

Recommend internal links to add to a target page from related hubs.

For target page {url}, find 10-15 relevant source pages on {domain} that should link to it. For each: suggested anchor text + sentence placement.
internal-linksrecommender
Audit v1.0

International SEO Audit

Audit multi-country/multi-language site setup: hreflang, ccTLDs, geo-targeting, content variations.

Audit international setup for {domain}. Report: hreflang completeness, ccTLD vs subfolder strategy, GSC geo-targeting, content variation per locale.
intlmulti-region
Technical v1.0

JS Rendering Audit

Audit JS-heavy site for content/links visible to Googlebot.

For {url} (JS-heavy), audit: raw HTML vs rendered DOM diff, JS-only content list, JS-only link list. Recommend SSR/hybrid strategy per content type.
jsrendering
Audit v1.0

JS Rendering Gap Detector

Find content that exists in rendered DOM but not raw HTML — the Googlebot blind spots.

Compare raw HTML and rendered DOM for {url}. List content (text, links, structured data) present only after JS execution. Estimate index risk per item.
jsrendering
Technical v1.0

JSON-LD Validator Brief

Build a JSON-LD validation step into a publishing workflow.

For publishing flow at {domain}, brief JSON-LD validation step: per-template schema spec, validator tool, pre-publish CI check, monitoring for runtime breakage.
schemavalidation
Ranking v1.0

Keyword Cannibalization Detector

Find queries where multiple pages from the same site compete in SERP.

For {domain}, find queries where 2+ pages from {domain} appear in top-20. For each cannibalization case: recommend canonical winner, consolidation strategy.
cannibalizationconsolidation
Ranking v1.0

Knowledge Graph Populator

Populate Knowledge Graph entities for a domain via Wikidata, Wikipedia, and structured data.

For domain {domain} entities (org, people, products), plan KG population: Wikidata items, Wikipedia presence, schema.org Organization/Person/Product on-site.
knowledge-graphwikidata
Audit v1.0

Knowledge Base SEO Audit

Audit help/KB articles for search visibility, question coverage, and SERP feature targeting.

Audit KB at {kb_url}. Report: article-to-query coverage, FAQ-schema usage, question vs statement titles, internal link density to KB from product pages.
kbdocs
GEO v1.0

Knowledge Graph Entity Check

Verify a brand/person/product has a Knowledge Graph entity and entity relationships are correct.

For entity {entity}, check Knowledge Graph presence (Google, Bing, Wikidata). Verify: name, description, sameAs links, entity relationships, image. Flag inconsistencies.
knowledge-graphentity
Ranking v1.0

Knowledge Panel Optimizer

Optimize a Knowledge Panel entry for a brand or entity.

For entity {entity}, audit current Knowledge Panel (image, description, sameAs, key facts). Recommend Wikipedia/Wikidata edits and schema additions to improve KP.
knowledge-panelentity
Content v1.0

Landing Page Copy Brief

Brief a high-intent landing page: above-fold structure, proof, friction-removal.

For landing page targeting {query} for {audience}, brief: above-fold hero, proof-block, friction-removal section, secondary CTA, FAQ, footer-CTA. Target 1 conversion goal.
landing-pagecro
Ranking v1.0

Listicle SERP Analyzer

Analyze top-ranking listicles for a query to identify the winning format.

For query {query} where listicles dominate SERP, analyze top-5 listicles: item count, item depth, schema use, internal linking pattern, intro length.
listicleformat
Content v1.0

Listicle Structure Generator

Generate a listicle structure with item-count rationale, ordering, and schema.

For topic {topic} as listicle, recommend: item count, ordering principle (best→worst/temporal/alphabetical), per-item structure, ItemList schema, intro length.
listiclestructure
GEO v1.0

LLM Citation Probability Predictor

Predict citation probability for a (URL, query) pair before publishing.

For URL {url} and query {query}, predict citation probability across 14 engines. Output: per-engine probability, top features driving the prediction, recommended changes.
predictionforecast
GEO v1.0

LLM-Friendly Schema Generator

Generate schema markup specifically tuned for LLM extraction (vs Google rich results).

For URL {url}, generate JSON-LD optimized for LLM extraction: dense factual claims, explicit relationships, no marketing fluff, sameAs links to authoritative entities.
schemallm
GEO v1.0

LLM Source Authority Model

Build a model of what makes a source authoritative in the eyes of LLMs (vs Google).

For domain {domain}, score LLM-authority across 14 engines. Compare to classic SEO authority (DR/DA). Identify divergence axes and target lift areas.
authorityllm-modeling
Ranking v1.0

Local Pack Analyzer

Analyze why competitors rank in the local pack for a target keyword and how to displace them.

For query {query} in location {location}, analyze top-3 local pack: GBP completeness, review velocity, category accuracy, citation breadth. Rank displacement difficulty.
local-packgbp
Ranking v1.0

Local Ranking Factor Audit

Audit a business across local ranking factors: GBP, citations, reviews, location pages.

For local business {business}, audit ranking factors: GBP completeness, NAP consistency across top citations, review velocity/sentiment, location-page coverage.
localranking
Audit v1.0

Local SEO Audit

Audit local SEO signals: GMB/GBP completeness, NAP consistency, local schema, location pages.

Audit local SEO for {business}. Verify: GBP profile completeness, NAP consistency across web, LocalBusiness schema, location-page coverage, citation profile.
localgbp
Content v1.0

Long-Form Content Brief (3000+)

Brief a long-form article that earns links + citations without padding.

For long-form target topic {topic}, brief 3000+ word piece: sub-topic depth justification, original research element, expert interview slots, custom-graphic plan.
long-formbrief
GEO v1.0

Long-Tail GEO Query Miner

Mine long-tail queries where the SERP is dominated by AI responses and competition is low.

For topic {topic}, identify long-tail queries with: high AI-response prevalence, low classic-SERP competition, transactional or commercial intent. Rank by opportunity.
long-tailmining
Ranking v1.0

Long-Tail Keyword Expander

Expand a seed keyword into 50+ long-tail variants ranked by opportunity.

For seed keyword {keyword}, expand into 50+ long-tail variants. For each: estimated volume, intent, competition, suggested target page on {domain}.
long-tailexpansion
Ranking v1.0

Manual Penalty Diagnoser

Diagnose a manual penalty from GSC and outline remediation steps.

For {domain} with manual penalty {penalty_type}, outline remediation: scope of affected URLs, fix per URL pattern, reconsideration request structure.
penaltyremediation
Content v1.0

Meta Description Rewriter

Rewrite meta descriptions for CTR without keyword-stuffing.

For {url_set}, rewrite meta descriptions: under 155 chars, contains query intent, includes CTA, no keyword stuffing. Output before/after table.
metactr
Technical v1.0

Microdata to JSON-LD Converter

Convert legacy microdata or RDFa markup to modern JSON-LD format.

For URL {url} using microdata/RDFa, convert to JSON-LD: preserve all properties, place in head, remove inline markup, verify rich-result eligibility.
schemamigration
Audit v1.0

Site Migration Readiness Audit

Pre-migration audit: URL inventory, redirect mapping, schema preservation, content parity.

Pre-migration audit for {domain} → {new_domain}. Output: URL inventory with redirect targets, schema preservation plan, content parity verification checklist.
migrationreadiness
Audit v1.0

Mobile-First Indexing Check

Verify a site renders, links, and structures identically on mobile vs desktop crawls.

Compare mobile and desktop renders of {url}. Flag content missing from mobile, links hidden behind tabs/accordions on mobile, and structured-data differences.
mobileindexing
Audit v1.0

Mobile Usability Audit

Audit mobile usability signals: tap targets, viewport, readable font size, intrusive interstitials.

Audit mobile usability of {url_set}. Report: tap-target spacing, viewport configuration, font-size readability, intrusive interstitials, horizontal scroll triggers.
mobileusability
Technical v1.0

Mobile Viewport Tag Check

Verify the viewport meta tag is set correctly for mobile responsiveness.

For {domain}, check viewport meta tag presence + content. Flag missing or misconfigured tags (initial-scale, user-scalable). Output corrected snippet.
viewportmobile
GEO v1.0

Multi-LLM SERP Analyzer

For a single query, compare citations across 5+ LLMs side by side.

For query {query}, run through ChatGPT, Claude, Gemini, Perplexity, and Copilot. Output a matrix: rows = engines, columns = cited domains, cells = rank.
multi-llmserp
GEO v1.0

Multi-Model Query Testing

Test a target query across 14 LLMs in parallel and aggregate the cited-domain distribution.

For query {query}, query 14 LLMs in parallel. Aggregate: unique cited domains, citation overlap matrix, response-length variance, refusal rate.
testingmulti-model
Content v1.0

Multi-Language Content Brief

Brief content for translation + localization (not just translation) across N locales.

For source page {url} and target locales {locale_list}, brief multi-lang plan: localized examples, cultural adaptations, hreflang tags, localized schema, local link plan.
intllocalization
Ranking v1.0

News SERP Visibility Check

For a publisher, audit visibility in news SERP across topic clusters.

For publisher {domain}, audit news-SERP visibility across topic clusters {topic_list}. Report: top-stories coverage, news-tab rank, news-sitemap completeness.
news-serppublisher
Audit v1.0

Noindex / Nofollow Audit

Find pages incorrectly noindexed (or correctly noindexed but linked from sitemap/internal nav).

Audit noindex/nofollow signals on {domain}. Flag: noindex pages linked from sitemap, noindex pages with strong internal links, accidentally-nofollowed internal links.
noindexmeta
Technical v1.0

Open Graph Meta Generator

Generate Open Graph meta tags for a page set, optimized for each social platform.

For URL set {url_set}, generate OG tags: og:title, og:description, og:image (1200×630), og:type, og:url. Recommend per-platform image variants.
open-graphsocial
Audit v1.0

Orphan Page Detection

Identify indexable pages with zero internal links pointing to them.

Cross-reference internal link graph with indexable URL inventory for {domain}. List orphan pages (indexable, 0 internal links) and suggest closest hub for each.
orphaninternal-links
Audit v1.0

Outbound Link Profile Audit

Audit outbound links for relevance, rel attributes, broken status, and risk.

Audit outbound links on {url_set}. Report: domain authority of each target, rel attributes, broken (4xx/5xx), and risk flags (low-trust domains).
outbound-linksrisk
Content v1.0

Outline Structurer

Build an SEO-optimized H-tag outline from a topic and competitor inputs.

For topic {topic}, build H1→H2→H3 outline. Reference top-5 ranking pages' structures. Optimize for skim-readability, semantic completeness, snippet-targeting.
outlinestructure
Ranking v1.0

People Also Ask Miner

Mine all PAA questions for a query cluster and prioritize for content creation.

For query {query}, expand PAA tree 3 levels deep. Cluster questions by intent. Rank by: search volume × current-coverage-gap on {domain}.
paaquestions
Audit v1.0

Pagination Strategy Audit

Verify pagination is crawlable, doesn't cannibalize, and surfaces deep pages to search.

Audit pagination on {paginated_url}. Report: rel-prev/next presence, view-all canonical strategy, page-N crawlability, deep-page index status, and tail-page link equity.
paginationcrawl
Technical v1.0

Pagination Rel Tags Generator

Generate rel=next/prev / canonical strategy for paginated content.

For paginated content {paginated_url}, generate pagination strategy: rel=next/prev (deprecated but still consumed), canonical (self vs view-all), crawl depth.
paginationrel-tags
GEO v1.0

Perplexity Citation Analyzer

Analyze Perplexity's citation pattern for a query and identify which sources it favors.

Run query {query} through Perplexity. List every cited domain, rank, and citation context. Identify the source-authority pattern Perplexity is rewarding.
perplexitycitations
Content v1.0

Pillar Page Architect

Design a pillar page: scope, structure, jump-nav, supporting content slots.

For pillar topic {topic}, design page: scope statement, H-tag structure, jump-nav anchors, sub-topic depth, FAQ block, links to spokes, schema strategy.
pillararchitecture
Content v1.0

Plagiarism Risk Brief

Pre-publish plagiarism + AI-detection risk check brief.

For draft {url}, brief pre-publish check: plagiarism scan tool/threshold, AI-detection tool/threshold, paraphrase-vs-original ratio target, citation completeness check.
plagiarismqa
Content v1.0

Podcast Show-Notes Writer

Generate SEO-friendly podcast show notes from an episode transcript.

From transcript {transcript_path}, generate show notes: episode summary (150 words), timestamped chapters, quotable lines, guest bio, related episodes, schema (PodcastEpisode).
podcasttranscript
Ranking v1.0

Pogo-Sticking Analyzer

Identify pages with high bounce-back-to-SERP behavior and the likely user-mismatch.

For {url_set}, identify pages with high pogo-sticking (back-to-SERP < 10s). Hypothesize user-mismatch: intent, content depth, page speed, UX friction.
pogoux
Ranking v1.0

Position Tracking Spec Builder

Build a position-tracking spec: keyword list, location, device, frequency.

For {domain} with priorities {priorities}, build position-tracking spec: 200-keyword list, locations, devices (mobile/desktop), tracking frequency, alert thresholds.
trackingspec
Audit v1.0

Post-Migration SEO Verification

Post-migration check: redirect chain integrity, indexation drop, traffic recovery signals.

Verify post-migration state for {domain}. Check: 301 chains intact, indexation delta, GSC errors delta, traffic recovery trajectory vs pre-migration baseline.
migrationrecovery
Content v1.0

Press Release SEO Optimizer

Optimize a press release for distribution pickup and SEO value.

For draft press release at {url}, optimize: SEO headline, dateline, fact-density, quotable lines, boilerplate, schema (NewsArticle), pickup-friendly structure.
prnews
Content v1.0

Product Description Writer

Write SEO + conversion-balanced product descriptions for an SKU set.

For SKU set {sku_list}, write product descriptions: lead with primary value prop, feature-bullets with benefits, schema (Product), avoid manufacturer-spec duplication.
productecommerce
Technical v1.0

PWA Manifest Reviewer

Review a PWA manifest for SEO and discovery.

For PWA manifest at {url}, review: name, short_name, description, icons (sizes), theme color, scope, start_url. Flag SEO-relevant issues.
pwamanifest
Ranking v1.0

Helpful Content Update Recovery

Recovery plan for a site hit by a Helpful Content style update.

For {domain} hit by Helpful Content update, audit: thin content, AI-generated low-value pages, doorway pages, ad density. Prioritize removal/improvement order.
hcuhelpful-content
Ranking v1.0

Question Query Miner

Mine all question-format queries for a topic.

For topic {topic}, mine question-format queries (what/why/how/when/where/who). Cluster by intent. Recommend FAQ block target page per cluster.
questionsfaq
GEO v1.0

RAG-Friendly Content Audit

Audit content for how well it's structured for retrieval-augmented generation systems.

Audit {url_set} for RAG-friendliness: chunk-size friendliness, semantic-paragraph structure, claim-density, internal references that won't survive retrieval. Score each.
ragstructure
Ranking v1.0

Rank Movement Analyzer

Analyze recent rank movements for a domain and explain each significant change.

For {domain}, analyze rank changes >5 positions in last 30 days. For each: page, query, magnitude, hypothesized cause (content/link/algo/SERP).
rank-movementanalysis
Ranking v1.0

Ranking Decline Diagnoser

For a page that lost rank, hypothesize the cause from on-page, off-page, and SERP signals.

Page {url} dropped from position {old_pos} to {new_pos} on query {query}. Diagnose: on-page changes, link changes, competitor moves, SERP-feature changes, algo signal.
declinediagnosis
Content v1.0

Readability Scorer

Score readability across multiple metrics and recommend simplification targets.

For {url}, score readability: Flesch, Gunning Fog, average sentence length, passive voice %, jargon density. Recommend top 5 sentences to simplify.
readabilityqa
Audit v1.0

Redirect Chain Analyzer

Find redirect chains and loops; recommend flattening to single hops.

Trace redirects from {url_set}. Flag chains >1 hop, loops, redirects to 4xx/5xx, and redirects that strip query params. Recommend flattened replacements.
redirectscrawl
Technical v1.0

Redirect Map Planner

Plan redirect map for a migration: old URL → new URL with chain prevention.

For migration {old_domain} → {new_domain} with URL pairs {pair_list}, plan redirect map: 301 directives, no chains, no loops, preserve query params per pattern.
redirectsmigration
Ranking v1.0

Rich Snippet Competitor Scan

For a query, identify which competitors get rich snippets and which schema they use.

For query {query}, scan top-20 for rich-snippet presence. Per competitor with rich snippet: schema type, key fields populated, what triggers display.
rich-snippetscompetitive
Technical v1.0

Robots Meta Tag Generator

Generate robots meta tag combinations per page template with rationale.

For templates {template_list} on {domain}, generate robots meta tag per template: index/noindex, follow/nofollow, max-snippet, max-image-preview, with rationale.
robots-metaindexing
Technical v1.0

Robots.txt Directive Generator

Generate a complete robots.txt for a site with rationale per directive.

For {domain} with goals {goals}, generate robots.txt: User-agent rules, Disallow/Allow paths with rationale, Sitemap directive, crawl-delay if needed.
robotscrawl
Audit v1.0

Robots.txt Directive Review

Verify robots.txt allows crawl of what should be crawled and blocks what should be blocked.

Review robots.txt at {domain}. Flag accidental blocks on key paths, missing Sitemap directive, conflicting Disallow rules, and User-agent-specific gotchas.
robotscrawl
Audit v1.0

SaaS Site SEO Audit

Audit feature pages, integration pages, comparison pages, and pricing page for SaaS SEO.

Audit SaaS site {domain}. Verify: feature-page intent coverage, integration-page templating, comparison-page tactics, pricing-page accessibility to crawlers.
saasb2b
Technical v1.0

Article Schema Generator

Generate Article schema (JSON-LD) for a blog post or news article.

For URL {url} with title {title}, author {author}, dates, image, generate Article JSON-LD: headline, datePublished, dateModified, author, publisher, mainEntityOfPage, image.
schemaarticle
Technical v1.0

BreadcrumbList Schema Generator

Generate BreadcrumbList schema matching visible breadcrumbs.

For URL {url} with breadcrumb path {path}, generate BreadcrumbList JSON-LD with itemListElement[] (position, name, item). Verify matches visible breadcrumb text.
schemabreadcrumb
Technical v1.0

Course Schema Generator

Generate Course schema for an online course with provider, instructor, and offers.

For course at {url}, generate Course JSON-LD: name, description, provider (Organization), instructor (Person), hasCourseInstance, offers, educationalLevel.
schemacourse
Technical v1.0

Event Schema Generator

Generate Event schema for in-person, online, or hybrid events.

For event {event_name} at {url}, generate Event JSON-LD: name, startDate, location (Place/VirtualLocation), offers, organizer, eventStatus, eventAttendanceMode.
schemaevent
Technical v1.0

FAQ Schema Generator

Generate FAQ schema for a Q&A block with snippet-eligibility checks.

For Q&A block on {url}, generate FAQPage JSON-LD. Verify: questions match visible text, answers under 800 chars, no contradictions, no marketing fluff.
schemafaq
Technical v1.0

HowTo Schema Generator

Generate HowTo schema for a step-by-step tutorial.

For tutorial at {url}, generate HowTo JSON-LD: name, totalTime, tool, supply, step[] with name/text/url/image. Verify each step has actionable text.
schemahow-to
Technical v1.0

ItemList Schema Generator

Generate ItemList schema for category, listicle, or curated list pages.

For list page {url} with items {item_list}, generate ItemList JSON-LD with itemListElement[], proper itemListOrder, and per-item url + name.
schemaitemlist
Technical v1.0

LocalBusiness Schema Generator

Generate LocalBusiness schema with hours, geo, payment options.

For local business {business_name}, generate LocalBusiness JSON-LD: name, address (PostalAddress), geo, openingHours, telephone, paymentAccepted, hasMap.
schemalocal
Technical v1.0

Organization Schema Generator

Generate Organization schema with logo, sameAs, contact, founder, and address.

For org {org_name}, generate Organization JSON-LD: name, url, logo, sameAs (social + Wikidata), contactPoint, founder, foundingDate, address.
schemaorganization
Technical v1.0

Person Schema Generator

Generate Person schema with sameAs links to authoritative entity sources.

For person {name}, generate Person JSON-LD: name, jobTitle, worksFor (Organization), sameAs (Wikipedia, Wikidata, LinkedIn, official site), image, knowsAbout.
schemaperson
Technical v1.0

Product Schema Generator

Generate Product schema with Offer, reviews, and aggregateRating.

For product {sku} with name, price, availability, reviews, generate Product JSON-LD: includes Offer, AggregateRating, Review samples, brand. Test in Rich Results Test.
schemaproduct
Technical v1.0

Recipe Schema Generator

Generate Recipe schema with nutrition, instructions, and ratings.

For recipe at {url}, generate Recipe JSON-LD: name, image, recipeIngredient[], recipeInstructions[], cookTime, totalTime, recipeYield, nutrition, aggregateRating.
schemarecipe
Technical v1.0

Review Schema Generator

Generate Review schema with proper rating, author, and item-reviewed linking.

For review on {url} of item {item}, generate Review JSON-LD: reviewBody, reviewRating (Rating), author, datePublished, itemReviewed. Avoid self-serving review warnings.
schemareview
Technical v1.0

SoftwareApplication Schema Generator

Generate SoftwareApplication schema with operating system, offers, and ratings.

For software {app_name}, generate SoftwareApplication JSON-LD: name, applicationCategory, operatingSystem, offers, aggregateRating, screenshot, softwareVersion.
schemasoftware
Audit v1.0

Schema Validation Sweep

Validate all JSON-LD on a URL set against the schema.org spec and Google's rich-result requirements.

Validate JSON-LD on {url_set} against schema.org + Google's rich-result spec. For each violation: severity, affected rich-result type, fix.
schemarich-results
Technical v1.0

VideoObject Schema Generator

Generate VideoObject schema for video SEO and key moments.

For video at {url}, generate VideoObject JSON-LD: name, description, thumbnailUrl, uploadDate, duration, contentUrl, embedUrl, hasPart (Clip[]) for key moments.
schemavideo
Audit v1.0

Security Header SEO Audit

Audit security headers for SEO impact (HSTS, X-Frame-Options, CSP, etc).

Audit security headers on {domain}. Report: HSTS configuration, X-Frame-Options, CSP, X-Content-Type-Options. Flag any blocking SEO tools or social previews.
headerssecurity
Technical v1.0

Security Header Configuration

Configure security headers without breaking SEO crawling or social previews.

For {domain}, configure security headers: HSTS, CSP (with image/script sources for social previews), X-Frame-Options, X-Content-Type-Options. Avoid OG-preview breakage.
headerssecurity
Ranking v1.0

SERP Feature Coverage Scorer

Score a site's SERP feature coverage vs total addressable features.

For {domain} across queries {query_list}, score SERP feature coverage: % of eligible features captured. Break down by feature type. Rank capture gaps by ease.
serp-featurescoverage
Audit v1.0

SERP Feature Coverage Audit

For target queries, map which SERP features the site currently captures vs is eligible for.

For target queries {query_list}, report current SERP feature presence and the site's capture status (own/competitor/none). Recommend capture targets ranked by feasibility.
serp-featuresvisibility
Ranking v1.0

SERP Intent Shift Detector

Detect queries where SERP intent has shifted (e.g., informational → commercial).

For query set {query_list}, compare current SERP intent mix vs 12-month-ago snapshot. Flag queries where intent has shifted; recommend content-format updates.
intent-shifttemporal
Ranking v1.0

SERP Volatility Tracker

Track SERP volatility for a query set over time to detect algorithm impact.

For query set {query_list}, track top-10 SERP weekly. Compute volatility score per query (rank changes / # keywords). Flag queries with sudden volatility spikes.
volatilitytracking
Audit v1.0

SSR vs CSR Audit

Determine if a site renders critical content server-side or relies on client-side JS.

Test {url} with JS disabled. Report what content/links/structured-data are present in raw HTML vs require JS. Flag SEO-critical content missing from raw HTML.
ssrcsr
Content v1.0

Service Page Brief

Brief a service page that ranks for service+location and converts.

For service {service} in location {location}, brief page: H1 pattern, what-you-get section, process, social proof, pricing transparency, FAQ, LocalBusiness schema.
servicelocal
Technical v1.0

Service Worker SEO Check

Verify a service worker doesn't break crawl or indexing.

For service worker at {sw_url}, verify: doesn't intercept HTML responses for bots, cache strategy doesn't serve stale to Googlebot, offline fallback doesn't indexable.
service-workerpwa
Ranking v1.0

Shopping SERP Analyzer

Analyze shopping SERP for a product query: prices, sellers, schema, image quality.

For query {query}, capture shopping-SERP. Report: price distribution, top sellers, shipping/return tags, image quality patterns, schema fields present.
shopping-serpecommerce
Content v1.0

Short-Form Content Brief (500-800)

Brief a punchy short-form piece optimized for AI snippet capture.

For short-form target query {query}, brief 500-800 word piece: lede answers query in <200 chars, 3-5 sub-sections, FAQ, internal links to deeper resources.
short-formsnippet
Audit v1.0

Internal Site Search SEO Audit

Verify internal search result pages aren't crawled, indexed, or generating index bloat.

Audit internal search on {domain}. Verify search-result URLs are blocked from crawl, noindex if reachable, and not leaking via internal/external links.
site-searchbloat
Audit v1.0

Site Structure Audit

Map a site's URL hierarchy and flag depth issues, hub coverage, and structural gaps.

Map URL hierarchy for {domain}. Report: max click depth from homepage, pages at depth >3, hub-page coverage per category, structural orphans.
structuredepth
Ranking v1.0

Sitelink Analyzer

Analyze why a brand search shows the sitelinks it does and how to influence them.

For brand query {brand}, audit current sitelinks. Identify the page-signals influencing sitelink choice. Recommend changes to surface preferred sitelinks.
sitelinksbrand
Audit v1.0

Sitemap XML Validation

Validate sitemap structure, freshness, indexable status of listed URLs, and coverage gaps.

Validate sitemap at {sitemap_url}. For each URL: HTTP status, indexable flag, lastmod plausibility. List indexable pages on-site that are absent from the sitemap.
sitemapindexing
Technical v1.0

Sitemap XML Generator

Generate sitemap structure (index + child sitemaps) for a large site.

For {domain} with URL inventory at {csv_path}, generate sitemap structure: sitemap-index, child sitemaps by template (max 50k URLs each), priority/changefreq strategy.
sitemaplarge-site
GEO v1.0

Source Diversity Scorer

Score how diverse the sources cited by LLMs are for a query (concentration vs long tail).

For query {query}, run through 5 LLMs. Compute Herfindahl-Hirschman concentration index for cited domains. Score: concentrated (winner-take-all) vs diverse.
diversityconcentration
Technical v1.0

Server-Side Rendering Spec

Specify SSR for a JS-rendered site: render budget, cache, dynamic content handling.

For {domain} (currently CSR), spec SSR migration: render budget per page, cache TTLs, dynamic-content handling, fallback strategy, SEO testing checklist.
ssrmigration
Audit v1.0

Structured Data Coverage Audit

Audit which page templates have what structured data, identify gaps and over-application.

Audit structured data coverage on {domain} by template. Report: which schema types per template, missing-but-eligible types, over-applied types, validation errors.
structured-datacoverage
Audit v1.0

Thin Content Identifier

Find pages with low word count, low engagement, and weak content signals.

List pages on {domain} with word count <300, time-on-page <30s, or no inbound internal links. Suggest: merge, expand, or noindex for each.
thin-contentquality
Ranking v1.0

Top-Rank Pattern Detector

Across a query set, identify common patterns in top-ranking pages.

For query set {query_list}, analyze top-3 ranking page per query. Identify recurring patterns: word count, H-tag structure, schema types, link density, brand mentions.
patternsanalysis
Ranking v1.0

Top-10 SERP Forensics

Reverse-engineer why each of the top-10 SERP results ranks where it does.

For query {query}, analyze top-10 SERP. For each result: hypothesized ranking factor mix (authority/relevance/freshness/intent), what specifically wins it the slot.
serp-analysisreverse-engineering
Content v1.0

Topic Cluster Planner

Plan a topic cluster: pillar page + 8-15 spokes with internal-link map.

For topic {topic} on {domain}, plan cluster: pillar page brief, 8-15 spoke brief titles, internal-link map (spoke→pillar, spoke→spoke), publish-order sequence.
clusterpillar
Technical v1.0

Twitter Card Meta Generator

Generate Twitter Card meta tags with proper card type per content type.

For URL set {url_set}, generate Twitter Card meta: twitter:card (summary vs summary_large_image), twitter:title, twitter:description, twitter:image, twitter:site.
twitter-cardssocial
Audit v1.0

URL Pattern Audit

Find inconsistent URL structures within a site (slash trailing, case, dashes vs underscores, etc).

Audit URL patterns on {domain}. Flag: inconsistent trailing slashes, mixed case, underscores vs dashes, query-vs-path patterns, parameter ordering.
url-patternsconsistency
GEO v1.0

Vector Embedding Optimizer

Optimize a page so embedding-based retrieval surfaces it for target intents.

For URL {url} targeting intent {intent}, generate the embedding-friendly variants: lede rewrites, semantic-anchor headings, redundant-phrasing reduction.
embeddingsretrieval
Content v1.0

Video Script SEO Brief

Brief a video script for both engagement and SEO transcript value.

For video topic {topic} on platform {platform}, brief script: hook (5s), 3-5 chapter beats with timestamps, B-roll plan, on-screen text (for transcript), CTA.
videoyoutube
Ranking v1.0

Video SERP Optimizer

Optimize a video for video-SERP visibility and key-moments capture.

For target query {query}, audit video-SERP. Recommend: title pattern, thumbnail design, chapter timestamps, transcript optimization, video schema fields.
video-serpyoutube
Technical v1.0

X-Robots-Tag HTTP Header Generator

Generate X-Robots-Tag headers for non-HTML resources (PDFs, images).

For non-HTML resources on {domain} (PDFs, images, JSON endpoints), generate X-Robots-Tag headers: per-resource indexing policy, served via web-server config.
x-robotsheaders
Ranking v1.0

Zero-Click SERP Analyzer

For high-impression / low-click queries, diagnose the zero-click cause and capture strategy.

For {domain} queries with impressions >1000 and CTR <1%, diagnose zero-click cause (SERP feature stealing, brand-only, low intent). Recommend capture or pivot.
zero-clickctr
GEO v1.0

AI Mode Query Cluster Fit Scorer

Scores a site's content against AI Mode query clusters to identify high-fit citation opportunities.

Given the following AI Mode query clusters for {niche}: {query_clusters}, and the content inventory for {site_url}: {content_list}, score each content asset for relevance fit (0–10), passage retrievability, and entity coverage. Output a ranked table of content assets most likely to be cited in AI Mode, with gaps highlighted...
geoai-modecitation
GEO v1.0

Brand Mention Context Signal Audit

Audits the context in which a brand is mentioned across web sources to assess LLM signal quality.

Collect the top 50 web mentions of {brand} from the following sources: {source_list}. For each mention, classify the context (positive/negative/neutral), proximity to relevant entities, anchor diversity, and whether the mention is in a passage likely retrieved by LLMs. Output a signal quality score and recommendations to improve mention context...
geobrand-mentioncontext
GEO v1.0

ChatGPT Brand Entity Readiness Audit

Assesses how accurately ChatGPT represents your brand entity and flags knowledge gaps.

Ask ChatGPT (GPT-4o) the following questions about {brand}: {question_list}. For each response, evaluate factual accuracy, attribute completeness, and sentiment. Identify which brand attributes are missing, incorrect, or positively/negatively framed, and recommend content or entity signals to correct each gap...
geochatgptentity
Ranking v1.0

Cluster Opportunity Size Estimator

Estimates the total addressable traffic opportunity for a topic cluster before content investment.

For the proposed topic cluster {cluster_topic} on {site_url}, compile all related keywords: {keyword_list}. For each keyword, apply a CTR curve based on target position, sum the total opportunity by position tier (1, 3, 5, 10), and output a cluster opportunity model with realistic 6-month traffic estimates and required page count...
rankingclusteropportunity-sizing
Ranking v1.0

Competitor Content SERP Gap Rank Finder

Finds keywords where competitors rank in positions 1–10 but your site has no ranking page.

Using the keyword ranking exports for {site_url} and competitors {competitor_list}: {ranking_data}, identify all keywords where at least 2 competitors rank in positions 1–10 and {site_url} ranks outside position 50 or has no ranking URL. Cluster these by topic and output a prioritized gap list with estimated traffic opportunity and recommended content type...
rankingcompetitor-gapkeywords
Audit v1.0

Crawl Budget Prioritization Audit

Reviews crawl allocation across a site and flags low-value URL patterns consuming budget.

Using the crawl log summary for {site_url} below: {crawl_summary}, identify URL patterns consuming disproportionate crawl budget (e.g., faceted params, session IDs, pagination), estimate the budget reclaimed by blocking each, and provide robots.txt or canonical recommendations...
auditcrawl-budgettechnical
Audit v1.0

Duplicate Content Faceted Nav Audit

Identifies duplicate and near-duplicate content generated by faceted navigation parameters.

For {site_url}, review the following list of faceted URL patterns and their canonical signals: {faceted_url_list}. Identify which parameter combinations produce duplicate or near-duplicate content, whether canonicals are self-referencing or pointing correctly, and recommend a noindex, canonical, or robots.txt treatment for each pattern...
auditduplicate-contentfaceted-nav
GEO v1.0

Entity Association Gap Mapper

Maps missing entity associations that weaken brand representation in LLM knowledge graphs.

For the brand entity {brand}, list the following known attributes: {attribute_list}. Then, using LLM probing and Knowledge Graph data, identify which associations are missing or weak (e.g., missing industry category, product lines, founder, headquarters). Output a gap map with entity, missing association, recommended content fix, and target publication type...
geoentityknowledge-graph
Ranking v1.0

Featured Snippet Format Type Planner

Identifies the dominant snippet format for target queries and prescribes content structure to win them.

For the following queries: {query_list}, identify the current featured snippet holder, the snippet format (paragraph, list, table, code), and the approximate character/word count. For each query, recommend the exact content format, length, and structure {site_url} should use to displace the current snippet holder...
rankingfeatured-snippetserp
Content v1.0

Internal Link Anchor Diversity Planner

Analyzes internal anchor text distribution and recommends a diverse, intent-aligned anchor strategy.

For the target page {target_url} on {site_url}, pull all current internal links and their anchor texts: {internal_link_data}. Classify anchors by type (exact-match, partial-match, branded, generic, naked URL). Identify over-optimized or generic patterns and recommend a diversified anchor text set for each linking opportunity with suggested source pages...
contentinternal-linksanchor-text
Audit v1.0

Log File Crawler Segment Audit

Segments server log data by bot type to diagnose crawl efficiency and waste.

Analyze the following server log extract for {site_url}: {log_data}. Segment requests by bot (Googlebot, Bingbot, other), identify over-crawled low-value URLs, under-crawled priority pages, and recommend crawl budget fixes...
auditlog-filecrawl-budget
Ranking v1.0

Knowledge Panel Signal Gap Audit

Identifies missing or weak signals preventing a brand from owning its Knowledge Panel.

For the entity {brand_or_person}, audit the current Knowledge Panel (if present) against the following signal checklist: Wikipedia article, Wikidata entry, structured data on site, Google Business Profile, social profile consistency, and authoritative third-party mentions. Flag each missing signal and provide a step-by-step acquisition plan...
rankingknowledge-panelentity
GEO v1.0

Multi-LLM Citation Slot Analysis

Compares which sources occupy citation slots across ChatGPT, Perplexity, and Claude for the same query.

For the query set {query_list}, test each query across ChatGPT, Perplexity, and Claude. Record the top 3 cited sources per LLM per query. Build a cross-LLM citation matrix identifying sources that consistently appear, LLM-specific preferences, and gaps where {brand} should be competing for citation...
geomulti-llmcitation
Ranking v1.0

News SERP Freshness Inclusion Planner

Plans publishing frequency, markup, and signals needed to gain and sustain News SERP inclusion.

For {site_url} targeting News SERP inclusion for the topic {news_topic}, audit current NewsArticle schema implementation, publishing velocity, sitemap news feed status, and Google News approval. Identify gaps against Google News content policies and output a 30-day publishing and technical plan to achieve News SERP visibility...
rankingnews-serpfreshness
Ranking v1.0

People Also Ask Intent Chain Builder

Traces PAA question chains for a seed query to uncover deep intent and content expansion opportunities.

Starting with the seed query {seed_query}, map the PAA question tree to at least 3 levels deep. For each question, classify the intent, identify whether {site_url} has existing content covering it, and output a content expansion plan prioritizing PAA questions by search volume, difficulty, and gap status...
rankingpaaintent
Technical v1.0

Prerender Eligibility Decision Spec

Evaluates whether a site's pages qualify for prerendering and specifies the implementation approach.

For {site_url} using {framework}, evaluate the following pages for prerender eligibility: {page_list}. For each page, assess: dynamic data dependency, auth-gated content, personalization layers, and JS execution complexity. Output a prerender eligibility matrix classifying each page as: static prerender, dynamic SSR, ISR, or client-side only, with the recommended implementation approach and tooling...
technicalprerenderingrendering
Audit v1.0

Schema Audit Type Coverage

Audits which schema types are present, missing, or malformed across a site's page templates.

Review the following list of page templates and their current schema markup for {site_url}: {template_list}. For each template, identify which schema types are implemented, which are missing based on page intent, and flag any invalid or incomplete properties...
auditschemastructured-data
Ranking v1.0

SERP Intent Volatility Cluster Audit

Groups keywords by SERP volatility and intent shift patterns to guide content update strategy.

For the keyword set {keyword_list}, pull 90-day SERP volatility scores and classify each keyword by intent type (informational, commercial, transactional, navigational). Identify keywords where intent has shifted in the last {n} days, cluster them by volatility tier, and recommend content adjustments for each tier...
rankingserp-intentvolatility
Content v1.0

Title Meta Batch Rewrite Scorer

Batch rewrites title tags and meta descriptions with CTR scoring for a list of URLs.

For the following list of URLs with current title tags and meta descriptions: {url_meta_list}, rewrite each title (50–60 chars) and meta description (150–160 chars) to improve CTR. Apply power word inclusion, primary keyword placement in first 60 chars, and emotional trigger scoring. Output a table with old vs. new copy and a predicted CTR lift score (1–5)...
contenttitle-tagctr
GEO v1.0

AEO Answer Format Optimization Brief

Creates a brief for reformatting content to maximize eligibility for AEO and generative answer extraction.

Analyze the page at {url} targeting the question {target_question}. Produce an AEO optimization brief specifying: (1) ideal answer format (paragraph, list, table), (2) optimal word count for the direct answer block, (3) supporting entity mentions to add, (4) FAQ schema block to append, and (5) internal links to authoritative supporting pages...
geoaeoanswer-format
GEO v1.0

AI Mode Query Cluster Targeting

Maps query clusters where AI Mode is triggered and builds a targeting plan to appear in those surfaces.

For the keyword set {keyword_list}, identify which queries trigger Google AI Mode responses. For each AI Mode query: (1) analyze the sources selected, (2) identify the content format used in the cited passages, (3) score {brand_domain}'s eligibility, and (4) produce a content rewrite plan for each gap...
geoai-modequery-clusters
GEO v1.0

AI Overview Passage Depth Analyzer

Evaluates whether existing content passages are deep enough to be selected for AI Overview citations.

Review the content at {url} targeting the query {target_query}. Score each passage (200–400 words) on: (1) direct answer density, (2) factual specificity, (3) source citation within text, and (4) semantic proximity to the query. Output a passage-level table with scores and rewrite recommendations...
geoai-overviewpassages
GEO v1.0

Brand Mention Context Gap Analyzer

Analyzes the context in which a brand is mentioned online to find gaps versus competitor mentions.

Compare brand mention contexts for {brand_name} versus {competitor_list} across news, forums, and reference sites. Identify: (1) topic associations present for competitors but absent for {brand_name}, (2) sentiment distribution differences, (3) mention authority source gaps, and (4) a content-and-PR plan to close the gaps...
geobrand-mentioncompetitor
Ranking v1.0

Branded Query SERP Feature Expander

Identifies SERP features triggered by branded queries and builds a plan to own each one.

For the brand {brand_name}, analyze the SERP for {branded_query_list} and identify all SERP features present (Knowledge Panel, Sitelinks, Reviews, FAQs, Videos, Social profiles). For each feature: (1) current ownership status, (2) gaps in {brand_name}'s control, and (3) technical or content actions to claim or enhance each feature...
rankingbranded-serpserp-features
Technical v1.0

CDN Cache Control SEO Spec

Specifies CDN cache-control rules optimized for SEO crawl efficiency and page speed.

For {cdn_provider} serving {site_url}, produce a cache-control configuration spec that: (1) sets appropriate TTLs for HTML, CSS, JS, and image asset types, (2) ensures Googlebot always receives fresh HTML for key URL templates {url_templates}, (3) configures stale-while-revalidate for blog content, and (4) avoids Vary header issues that block caching...
technicalcdncache-control
GEO v1.0

ChatGPT Entity Citation Gap Planner

Identifies entity and factual gaps preventing ChatGPT from citing a brand in relevant responses.

Test ChatGPT with the queries {query_list} related to {brand_name} in {industry}. For each response where {brand_name} is not cited, analyze: (1) which entities ARE cited and why, (2) what factual claims the response makes that {brand_name} content does not address, and (3) a gap-fill content plan...
geochatgptentity
Content v1.0

Content Brief Search Intent Matrix

Creates a content brief built around a multi-intent matrix to satisfy all user intent layers for a topic.

For the target keyword {target_keyword} with a monthly search volume of {msv}, produce a content brief that includes: (1) primary, secondary, and latent intent classification, (2) SERP feature targets, (3) required entities and LSI terms, (4) recommended structure with H2/H3 outline, (5) E-E-A-T signals to incorporate, and (6) internal linking plan...
contentbriefintent
Content v1.0

Content Decay Ranking Drop Diagnosis

Diagnoses the root cause of content decay for a specific URL by analyzing ranking, content, and SERP signals.

For {url} which has seen rankings drop from position {peak_position} to {current_position} for {target_keyword} between {start_date} and {end_date}, diagnose: (1) content freshness vs top competitors, (2) new SERP features displacing organic clicks, (3) E-E-A-T signal gaps vs current ranking pages, (4) technical issues introduced in the period, and (5) a prioritized recovery plan...
contentcontent-decaydiagnosis
Content v1.0

Content Gap SERP Whitespace Finder

Finds under-served sub-topics in SERP results that represent content whitespace opportunities.

Analyze the top 10 SERP results for {target_query} and identify sub-topics that: (1) appear in PAA but are not covered by any ranking page in depth, (2) are mentioned in competitor meta descriptions but lack dedicated sections, (3) have high semantic relevance to {target_query} but zero ranking URLs. Output a whitespace opportunity table...
contentgap-analysiswhitespace
Content v1.0

Content Outline FAQ Expansion Builder

Expands a content outline with a structured FAQ section targeting PAA and voice search queries.

Given the content outline for {page_title} targeting {primary_keyword}, generate an expanded FAQ section of {num_questions} questions. For each FAQ: (1) source the question from PAA, forums, or autocomplete, (2) write a 40–60 word direct answer, (3) tag the intent type, and (4) format as FAQPage schema-ready markup...
contentfaqoutline
Content v1.0

Content Refresh Traffic Impact Prioritizer

Scores existing content assets by refresh ROI potential using traffic decay and ranking position data.

Using the GSC data export {gsc_export} and crawl data {crawl_data} for {site_url}, score each content asset on: (1) traffic loss velocity (last 6 months), (2) current ranking position vs historical peak, (3) SERP competition change, (4) content age vs freshness requirement, and (5) update effort estimate. Output a ranked refresh queue...
contentrefreshprioritization
Content v1.0

E-E-A-T Author Expertise Signal Builder

Builds a concrete plan to strengthen author expertise signals on a page to improve E-E-A-T scoring.

For the author {author_name} contributing to {site_url} in the topic area {topic_area}, audit existing expertise signals and produce a plan to add: (1) an optimized author bio with credentials, (2) linked third-party bylines and publications, (3) author schema markup, (4) first-person experience signals within content, and (5) Google Scholar or publication links...
contente-e-a-tauthor
Ranking v1.0

Featured Snippet Table Format Optimizer

Rewrites content sections into table format to target comparison and list-style featured snippets.

For the query {target_query} where Google shows a table-format featured snippet, rewrite the relevant section of {url} as an HTML table. Include: (1) column headers matching user intent, (2) 5–8 rows of specific data, (3) a concise intro sentence above the table, and (4) a natural prose paragraph below for context...
rankingfeatured-snippettables
GEO v1.0

Generative SERP Source Diversity Audit

Audits the diversity of source types cited in generative SERP features for a target topic set.

For the topic set {topic_list}, collect generative SERP sources (AI Overviews, AI Mode, Perplexity). Analyze: (1) source type distribution (news, blog, reference, gov), (2) content age distribution, (3) domain concentration, and (4) where {brand_domain} could realistically enter the citation pool...
geogenerative-serpcitations
Audit v1.0

Image SEO Compression Alt Audit

Audits image alt text quality, file size, format, and structured data eligibility across key pages.

Review the image inventory {image_inventory} from {site_url} and produce a report covering: (1) missing or keyword-absent alt text, (2) images exceeding {size_kb}KB without next-gen format, (3) images missing license/IPTC metadata, and (4) pages eligible for image rich results...
auditimage-seorich-results
Audit v1.0

Internal Link Depth Bottleneck Finder

Identifies pages buried too deep in site architecture that are losing crawl and ranking potential.

Given the crawl depth report {crawl_depth_report} for {site_url}, flag all pages more than {max_depth} clicks from the homepage, cross-reference with their GSC impressions and organic traffic, and recommend architecture changes to bring high-value pages within 3 clicks...
auditcrawlarchitecture
Ranking v1.0

Image SERP Structured Data Gap Fixer

Identifies structured data gaps preventing images from ranking in image SERP rich features.

Audit the images on {url_list} for image SERP eligibility. For each image, check: (1) presence of ImageObject schema, (2) license metadata, (3) alt text keyword alignment with {target_queries}, (4) page topical relevance, and (5) Core Web Vitals impact. Output a fix table with effort and impact scores...
rankingimage-serpstructured-data
Technical v1.0

JSON-LD FAQ Schema Code Builder

Generates valid FAQPage JSON-LD schema markup from a list of question-and-answer pairs.

Generate a valid FAQPage JSON-LD block for the following Q&A pairs: {qa_pairs}. Ensure: (1) all special characters are escaped, (2) answers are under 300 words each, (3) the block is wrapped in a <script type='application/ld+json'> tag, and (4) the output passes Google's Rich Results Test requirements...
technicalschemajson-ld
Ranking v1.0

Local Pack Review Signal Optimizer

Analyzes review signals affecting local pack rankings and recommends a review acquisition strategy.

For the Google Business Profile {gbp_url} in the category {business_category} targeting {target_location}, analyze: (1) review count vs top 3 local pack competitors, (2) review recency distribution, (3) keyword mentions in reviews, (4) response rate and quality, and (5) a 60-day review signal improvement plan...
rankinglocal-packreviews
Audit v1.0

Log File Segment Deep Dive

Analyzes log file data segments to surface crawl anomalies and bot behavior patterns.

Review the following log file sample {log_sample} and identify: (1) which URLs Googlebot crawls most vs least, (2) crawl frequency gaps vs sitemap priority, (3) any 4xx/5xx patterns by URL template, and (4) crawl waste opportunities...
auditlog-filecrawl
Audit v1.0

Mobile-First Content Parity Audit

Checks whether mobile page versions have content, structured data, and link parity with desktop.

Compare the mobile and desktop rendered HTML for {url_list} and identify: (1) content truncated on mobile, (2) structured data missing from mobile DOM, (3) internal links absent on mobile, and (4) lazy-loaded images not visible to Googlebot...
auditmobile-firstrendering
GEO v1.0

Multi-LLM Citation Frequency Tracker

Tracks how frequently a brand or domain is cited across multiple LLMs for a defined query set.

For the query set {query_list}, record responses from ChatGPT, Claude, Perplexity, and Gemini. Build a citation frequency matrix showing: (1) citation rate per LLM per query, (2) anchor context used when {brand_domain} is cited, (3) LLMs where citation rate is lowest, and (4) content improvement priorities...
geomulti-llmcitations
Audit v1.0

Orphan Page Link Path Tracer

Traces link paths to find truly orphaned pages with no internal link equity flowing to them.

Using the crawl export {crawl_export} and internal link map {link_map}, identify all URLs that receive zero internal links, are not in the XML sitemap, and still appear in Google Search Console as indexed. Output a table with URL, GSC impressions, and recommended link insertion points...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Intent Depth Expansion Planner

Mines People Also Ask trees to uncover deep intent layers and map them to content opportunities.

Starting from the seed query {seed_query}, extract 3 levels of PAA questions. For each question: (1) classify intent (informational, navigational, commercial, transactional), (2) estimate difficulty vs. opportunity, (3) check if {site_url} has existing coverage, and (4) assign to a new or existing content asset...
rankingpaaintent
GEO v1.0

Perplexity Source Preference Profile

Profiles which source types and content signals Perplexity consistently cites for a given topic cluster.

For the topic cluster {topic_cluster}, run the following 10 queries {query_list} in Perplexity and record all cited sources. Analyze: (1) domain authority distribution of cited sources, (2) content format patterns (lists, tables, studies), (3) average content freshness, and (4) gaps where {brand_domain} is absent...
geoperplexitycitations
Technical v1.0

Prerender Bot Detection Config Spec

Specifies bot-detection logic and prerender routing rules for a JavaScript-heavy site.

For {site_url} built on {framework}, write a prerender routing configuration that: (1) detects Googlebot, Bingbot, and social media crawlers via User-Agent, (2) routes detected bots to the prerender service {prerender_service}, (3) excludes admin, checkout, and account URL patterns, (4) sets a prerender cache TTL of {cache_ttl} hours, and (5) includes middleware code for {server_type}...
technicalprerenderingjavascript
Technical v1.0

Redirect 301 vs 302 Decision Spec

Produces a decision framework and implementation spec for choosing redirect types across site use cases.

For the redirect scenarios listed in {redirect_scenarios} on {site_url}, classify each as requiring a 301, 302, 307, or 308 redirect. For each: (1) explain the SEO implication of the redirect type, (2) specify the server-side implementation for {server_type}, (3) flag any that are currently misconfigured, and (4) provide the corrected directive or rule...
technicalredirectsimplementation
Technical v1.0

Robots.txt Crawl Waste Blocker

Generates robots.txt directives to block crawl waste URLs while preserving all crawlable priority pages.

Given the crawl waste URL patterns {waste_patterns} identified from log file analysis of {site_url}, generate a robots.txt directive set that: (1) blocks session IDs, faceted nav parameters, and internal search URLs, (2) preserves crawl access to all URLs in the XML sitemap, (3) adds a crawl-delay only for aggressive bots, and (4) includes inline comments explaining each rule...
technicalrobots-txtcrawl-budget
Audit v1.0

Schema Coverage Type Mapper

Maps existing schema markup types across a site and flags missing or misapplied types.

Given this list of URLs and their existing schema types {schema_inventory}, identify which page templates are missing high-value schema types (Article, FAQPage, HowTo, Product, BreadcrumbList, etc.), and output a prioritized remediation table...
auditschemastructured-data
Content v1.0

Schema-Rich Listicle Content Drafter

Drafts a listicle article with embedded ItemList schema targeting featured snippet and rich result capture.

Write a {num_items}-item listicle article titled '{article_title}' targeting the query {target_query}. For each item include: (1) a bolded H3 item name, (2) 80–120 words of specific, factual description, (3) a pro tip callout, and (4) an ItemList JSON-LD block for the full article with @type ListItem entries...
contentschemalisticle
Technical v1.0

Security Header CSP SEO Config

Generates a Content Security Policy and security header set that does not break SEO rendering or analytics.

For {site_url}, generate a complete HTTP security header configuration including: (1) Content-Security-Policy that allows Google Tag Manager, Search Console verification, and {analytics_platform} without 'unsafe-inline', (2) X-Frame-Options, (3) Referrer-Policy set to 'strict-origin-when-cross-origin', and (4) Permissions-Policy. Flag any directives that would block Googlebot's rendering of critical content...
technicalsecurity-headerscsp
Technical v1.0

Server-Side Rendering SEO Config Audit

Audits SSR configuration for a JavaScript framework to ensure Googlebot receives complete rendered HTML.

Audit the SSR configuration of {framework} for {site_url}. Check: (1) whether all critical SEO tags (title, meta description, canonical, hreflang) are present in the initial HTML response, (2) Time to First Byte impact of SSR vs CSR, (3) hydration errors that corrupt rendered content, and (4) bot-specific rendering fallback rules. Output a fix-priority table...
technicalssrrendering
Ranking v1.0

Shopping SERP Product Feed Gap Audit

Audits product feed attributes and on-page data to improve Shopping SERP eligibility and performance.

Review the product feed export {feed_export} for {merchant_name}. Identify: (1) missing required attributes (GTIN, brand, MPN), (2) titles lacking high-intent search terms for {product_category}, (3) images below quality threshold, (4) price competitiveness vs top shopping SERP competitors {competitor_list}, and (5) a feed optimization priority list...
rankingshopping-serpproduct-feed
Content v1.0

Title Tag SERP Click Gap Rewriter

Rewrites title tags for pages with high impressions but low CTR by analyzing SERP click-gap patterns.

For the pages in {low_ctr_url_list} with >500 GSC impressions and CTR below {ctr_threshold}%, analyze the SERP title competition for each and rewrite title tags to: (1) front-load the primary keyword, (2) add a power word or number, (3) stay within 55–60 characters, and (4) differentiate from competing titles. Output old vs new in a table...
contenttitle-tagctr
Content v1.0

Topic Cluster Spoke Content Brief

Generates a spoke page content brief designed to feed authority back to a defined cluster hub.

For the cluster hub {hub_url} targeting {hub_keyword}, create a spoke page content brief for {spoke_keyword}. Include: (1) target word count based on SERP analysis, (2) H2/H3 structure, (3) entities to mention for hub topic reinforcement, (4) exact internal link anchor text to use when linking to {hub_url}, and (5) CTA recommendation...
contenttopic-clusterbrief
Ranking v1.0

Video SERP Chapter Schema Optimizer

Optimizes video content and VideoObject schema to capture video SERP features including chapters.

For the video at {video_url} targeting {target_query}, produce: (1) an optimized VideoObject JSON-LD block with name, description, thumbnailUrl, uploadDate, duration, and embedUrl, (2) a Clip schema for {num_chapters} chapters with timestamps, (3) transcript excerpt recommendations for description field, and (4) page embedding recommendations...
rankingvideo-serpschema
Technical v1.0

XML Sitemap Priority Signal Engineer

Rebuilds XML sitemap structure with accurate priority and changefreq signals aligned to content type.

For {site_url} with {page_count} pages, generate a sitemap index configuration that: (1) splits sitemaps by content type (blog, product, category, landing page), (2) assigns priority values based on GSC impression data {gsc_data}, (3) sets changefreq aligned to actual update frequency per template, and (4) excludes all non-canonical and noindex URLs...
technicalsitemapcrawl
GEO v1.0

Brand Mention Context Analyzer

Diagnoses how LLMs contextually frame a brand and identifies sentiment or association gaps.

Query {llm_list} with the prompt 'What do you know about {brand}?' and variants covering {topic_list}. Catalog the exact context, sentiment, and co-mentioned entities for each response, then identify association gaps that need content or PR reinforcement...
geobrand-mentionentity
Ranking v1.0

Branded vs Nonbranded Opportunity Map

Analyzes branded and non-branded query split to reveal non-brand ranking headroom.

Using the Google Search Console data for {domain} covering {date_range}: {gsc_data}, calculate the branded vs non-branded impression and click share. For the non-branded segment, identify the top 20 queries with high impressions but CTR below {ctr_threshold}% and prescribe title/meta improvements...
rankingbrandedgsc
GEO v1.0

Citation Signal Content Checklist

Generates a pre-publish checklist ensuring content meets LLM citation signal requirements.

Review the following draft article for {topic}: {content_draft}. Evaluate it against LLM citation signals including factual density, entity specificity, external source references, passage scannability, and structured data presence, then output a pass/fail checklist with edits...
geocitationcontent-signals
Content v1.0

FAQ Schema Intent Generator

Generates FAQ blocks with schema markup tailored to PAA questions for a target page.

For the target page {page_url} on {domain} targeting {primary_keyword}, extract the top 10 People Also Ask questions from the SERP. Write concise, schema-ready Q&A pairs answering each question, then output the complete FAQPage JSON-LD block ready to embed...
contentfaqschema
Audit v1.0

Hreflang Return Tag Sweep

Checks all hreflang tags across locales for missing or broken reciprocal return tags.

Review the hreflang implementation data below for {domain} across {locale_list} locales. Identify every locale pair missing a valid return tag, conflicting annotations, and self-referencing errors...
audithreflanginternational
Technical v1.0

Hreflang XML Locale Matrix Builder

Builds a complete hreflang XML sitemap matrix for a multi-locale site with x-default handling.

Generate a complete hreflang XML sitemap for {domain} covering the following locale-URL mapping: {locale_url_map}. Include x-default entries, ensure all return tags are reciprocal, use the correct language-region ISO codes, and flag any locale pairs where the return tag would be missing...
technicalhreflangsitemap
Audit v1.0

Image SEO Alt Text Audit

Audits image alt text, filenames, and structured data across a page set for SEO compliance.

Review the image inventory below for {domain}: {image_data}. For each image, evaluate alt text descriptiveness, filename SEO-friendliness, presence of structured data, and file format/size efficiency, then output a prioritized fix list...
auditimage-seoaccessibility
GEO v1.0

LLM Source Authority Drift Audit

Tracks shifts in which sources LLMs prefer for a topic over two time periods.

Compare LLM citation data for {topic} collected in {period_1} vs {period_2} across {llm_list}. Identify sources that gained or lost citation frequency, hypothesize content changes that drove drift, and recommend actions for {domain} to capitalize on shifts...
geollmsource-drift
Audit v1.0

Log File Segment Audit

Analyzes server log file segments to surface Googlebot crawl frequency and anomalies.

Given the following server log excerpt for {domain}, identify Googlebot crawl frequency by URL, flag uncrawled priority pages, detect crawl traps, and summarize wasted crawl budget by directory...
auditlog-filecrawl-budget
Content v1.0

Meta Description Batch Rewriter

Rewrites a batch of underperforming meta descriptions to improve SERP CTR using intent signals.

Rewrite the meta descriptions for the following pages on {domain}: {url_meta_list}. For each, analyze the target query intent, current CTR from GSC, and top-ranking competitor meta descriptions. Produce a new meta description under 155 characters that leads with the primary benefit and includes a CTA...
contentmeta-descriptionctr
GEO v1.0

Multi-LLM Source Variance Map

Compares citation sources across ChatGPT, Claude, and Perplexity for the same query set.

For each query in {query_list}, record the top cited sources from ChatGPT, Claude, and Perplexity. Build a variance matrix showing which sources appear in all three, only one, or two LLMs, and explain the content signals driving each LLM's preference...
geomulti-llmcitation
Ranking v1.0

PAA Question Cluster Builder

Mines People Also Ask chains for a seed query and organizes them into content-ready clusters.

Starting from the seed query {seed_query}, recursively map all People Also Ask questions through at least three expansion levels. Group questions into thematic clusters, identify which clusters {domain} has no content for, and rank clusters by estimated impression volume...
rankingpaakeyword-research
Content v1.0

Programmatic SEO Template Builder

Creates a scalable programmatic content template with variable slots for a defined page type.

Design a programmatic content template for {page_type} pages on {domain} targeting {keyword_pattern}. Define all variable slots ({variables}), static boilerplate sections, internal link logic, schema type, and quality guardrails to prevent thin content at scale...
contentprogrammatic-seotemplate
Content v1.0

Schema-Rich HowTo Content Drafter

Drafts a HowTo article structured for rich results with embedded HowTo JSON-LD schema.

Write a complete HowTo article for the topic {howto_topic} targeting {target_keyword}. Structure it with a tool/materials list, numbered steps under 75 words each, and an introductory paragraph optimized for featured snippets. Append a valid HowTo JSON-LD schema block matching every step in the article...
contenthow-toschema
Ranking v1.0

SERP Volatility Query Diagnosis

Diagnoses ranking volatility for a query set by correlating rank swings with algorithm signals.

Given the rank tracking history for {domain} on {query_list} over {date_range}: {rank_data}, identify queries with >5 position swings, correlate spikes with known algorithm updates or competitor changes, and output a root-cause hypothesis with stabilization recommendations...
rankingvolatilityserp
Technical v1.0

Server-Side Rendering SEO Audit

Evaluates whether a site's SSR implementation correctly serves SEO-critical content to Googlebot.

Audit the SSR implementation for {domain} using the following Googlebot render output vs browser render comparison: {render_diff}. Identify any SEO-critical content (headings, body text, internal links, structured data) missing from the server response and prescribe hydration or rendering fixes...
technicalssrrendering
Audit v1.0

Technical Site Audit Blueprint

Generates a structured technical site audit checklist scoped to a given domain and CMS.

Produce a prioritized technical SEO audit checklist for {domain} running on {CMS}. Cover crawlability, indexing, page speed, structured data, and mobile rendering, flagging critical issues first...
audittechnicalcrawl
Content v1.0

Topic Cluster Gap Finder

Identifies missing spoke pages in an existing topic cluster that are ranking for competitors.

Map the existing topic cluster for {pillar_topic} on {domain}. Using the competitor domains {competitor_list}, identify subtopics they rank for in the top 10 that {domain} has no content covering. Prioritize gaps by estimated search volume and topical authority contribution...
contenttopic-clustergap-analysis
Ranking v1.0

Video SERP Schema Opportunity

Finds video content opportunities and schema gaps to capture video SERP rich results.

For the query cluster {query_cluster}, analyze which queries trigger video carousels in the SERP. Review {domain}'s existing video content and schema markup. Identify queries where a new or optimized video with VideoObject schema could displace {competitor_domains} in the video SERP...
rankingvideo-serpschema
Content v1.0

Anchor Text Diversity Gap Audit

Analyses internal anchor text distribution to surface over-optimisation and diversity gaps by target page.

You are an internal link anchor text analyst. Given the internal link export for {domain}: {internal_link_export}, analyse the anchor text distribution for each of the top 50 target pages by ranking priority. Identify pages with over 60% exact-match anchor text, pages with exclusively generic anchors (click here, read more), and gaps in topically relevant partial-match anchors. Produce a diversification plan per page...
contentanchor-textinternal-links
GEO v1.0

Brand Mention Gap Diagnostics

Diagnoses where brand mentions are absent in LLM-generated answers and why competitors are named instead.

You are a brand GEO analyst. Run the following 15 brand-adjacent queries through an LLM: {query_list}. For each response, note whether {brand} is mentioned, which competitors are named instead, and the contextual reason for competitor selection. Produce a diagnostic report with mention rate, competitor mention rate, and content/entity gaps preventing {brand} citation...
geobrand-mentionsdiagnostics
Ranking v1.0

Competitor Content SERP Gap Rank

Finds keywords where top competitors rank but your domain has no ranking page at all.

You are a competitive SEO analyst. Given the following keyword ranking exports for {domain} and competitors {competitor_list}: {ranking_data}, identify all keywords where at least two competitors rank in the top 20 but {domain} has no ranking URL. Group gaps by topic cluster, estimate traffic opportunity using search volume, and prioritise by commercial intent and competition level...
rankingcompetitor-gapkeywords
GEO v1.0

AEO Question Answer Depth Scorer

Scores existing Q&A content for answer depth and specificity required for AEO and GEO citation.

You are an Answer Engine Optimisation specialist. Evaluate the following Q&A content blocks from {url} against the AEO scoring criteria: answer completeness (does it fully resolve the query?), specificity (does it include statistics, named entities, dates?), structure (is it scannable for LLM extraction?), and authority signals (are sources cited?). Score each block 1-10 per dimension and recommend improvements...
geoaeoanswer-quality
Content v1.0

Content Decay Revenue Impact Brief

Calculates the estimated revenue impact of content decay and builds a recovery prioritisation brief.

You are a content ROI analyst. Using the following organic traffic and conversion data for {domain}: {traffic_conversion_data}, identify pages that have lost more than 20% organic traffic year-over-year. For each decaying page, calculate estimated revenue lost using average conversion rate and order value. Rank by revenue impact and produce a recovery brief for the top 10 highest-loss pages...
contentcontent-decayrevenue
Content v1.0

Content Gap Cluster Opportunity

Identifies topical cluster gaps between your content inventory and competitor coverage.

You are a content gap analyst. Compare the content inventory of {domain} against competitors {competitor_list} across the topic cluster '{cluster_topic}'. Identify sub-topics, question types, and content formats that competitors cover but {domain} does not. Score each gap by search volume, commercial value, and production effort. Output a prioritised gap matrix with brief content spec for each item...
contentcontent-gaptopic-cluster
Content v1.0

Content Refresh Traffic Prioritiser

Ranks existing content pages by refresh ROI based on traffic decay, ranking position, and topic freshness.

You are a content refresh strategist. Analyse the following content performance data for {domain}: {content_performance_csv}. Score each page for refresh priority based on: organic traffic decline over 6 months, current average ranking position, topic search trend direction, and content age. Weight scores to produce a top 20 refresh priority list with recommended refresh type (update facts, expand depth, restructure, or full rewrite)...
contentcontent-refreshtraffic
Technical v1.0

Edge SEO Worker Redirect Spec

Writes a Cloudflare Worker script to handle SEO-critical redirects and header modifications at the edge.

You are an edge SEO engineer. Write a Cloudflare Worker script for {domain} that handles the following SEO requirements at the edge: 301 redirects for {redirect_rules}, injection of canonical headers for {canonical_rules}, and addition of X-Robots-Tag headers for {noindex_paths}. Include error handling, performance considerations, and deployment instructions as code comments...
technicaledge-seocloudflare
Content v1.0

E-E-A-T Author Credibility Audit

Scores author credibility signals across content pages against Google's E-E-A-T quality criteria.

You are an E-E-A-T auditor. Review the author bios and byline signals for {domain}'s content team. For each author, score the following dimensions out of 10: demonstrated first-hand experience, formal expertise credentials, external authority signals (publications, mentions, profiles), and trustworthiness indicators (disclosures, contact info, editorial policies). Produce a scorecard and improvement plan per author...
contente-e-a-tauthor
Audit v1.0

Faceted Nav Crawl Budget Audit

Audits faceted navigation parameters to identify URL combinations wasting crawl budget.

You are a technical SEO specialist focusing on e-commerce crawl efficiency. Given the following list of faceted navigation URLs discovered on {domain}: {faceted_url_list}, identify parameter combinations that create duplicate or near-duplicate content, estimate the crawl budget waste, and recommend a parameter handling strategy using robots.txt, rel=canonical, or URL parameter tools...
auditfaceted-navcrawl-budget
Content v1.0

FAQ Entity Schema Content Generator

Generates FAQ content blocks with embedded entities and ready-to-deploy FAQPage schema markup.

You are a structured content specialist. Generate 10 FAQ pairs for the topic '{topic}' targeting the audience '{audience}' on {domain}. Each answer must be 40-60 words, include at least one named entity, and directly resolve the question. After producing the FAQ content, output the complete FAQPage JSON-LD schema block ready for deployment in the page <head>...
contentfaqschema
GEO v1.0

Generative SERP Entity Prominence Brief

Creates a brief to increase brand entity prominence in generative SERP features and AI answers.

You are a generative SERP optimisation expert. Analyse the current entity prominence of {brand} for the topic '{topic}' by reviewing AI Overview responses, Perplexity answers, and ChatGPT outputs. Score prominence out of 10, identify entity attributes (description, associations, credentials) that are under-represented, and produce a structured content and PR brief to increase prominence...
geoentitygenerative-serp
Audit v1.0

Hreflang Return Tag Checker

Validates that every hreflang tag has a reciprocal return tag across all locale variants.

You are an international SEO auditor. Review the following hreflang tag dataset for {domain}: {hreflang_data}. For each hreflang annotation, verify that the referenced alternate URL includes a reciprocal return tag pointing back to the source. List all missing return tags, self-referencing errors, and locale code mismatches in a structured table...
audithreflanginternational
Technical v1.0

JSON-LD Schema Validation Repair

Validates raw JSON-LD schema markup, identifies errors, and outputs a corrected deployment-ready version.

You are a structured data engineer. Validate the following JSON-LD schema markup from {url}: {json_ld_code}. Check for: missing required properties per schema.org spec, incorrect data types, invalid enum values, broken @context references, and Google rich-result eligibility criteria. Output a validation report listing each error with its location, the rule violated, and the corrected JSON-LD block...
technicalschemajson-ld
Audit v1.0

Image SEO Metadata Audit

Audits image alt text, file names, dimensions, and structured data across a site's image inventory.

You are an image SEO auditor. Analyse the following image inventory export for {domain}: {image_inventory_csv}. Evaluate each image for missing or generic alt text, non-descriptive file names, missing width/height attributes, excessive file size, and absence from the XML image sitemap. Output a prioritised fix list with current value, recommended value, and impact...
auditimage-seometadata
Audit v1.0

Mobile-First Rendering Gap Audit

Compares desktop and mobile-rendered HTML to detect content hidden from Googlebot's mobile crawler.

You are a mobile-first indexing specialist. Compare the following desktop-rendered HTML and mobile-rendered HTML for {url}: {desktop_html} vs {mobile_html}. Identify all content, links, structured data, and meta tags present on desktop but absent or truncated on mobile. Output a delta table with element type, desktop value, mobile value, and SEO impact rating...
auditmobile-firstrendering
Technical v1.0

Prerender Eligibility Configuration Spec

Determines prerendering eligibility for key pages and generates the Speculation Rules API configuration.

You are a prerendering SEO engineer. Evaluate the following page types on {domain} for prerender eligibility using the Speculation Rules API: {page_type_list}. For each page type, assess disqualifying factors (authentication walls, personalisation, POST requests, dynamic headers). For eligible pages, produce the Speculation Rules JSON configuration and the script tag implementation ready for deployment...
technicalprerenderingspeculation-rules
Technical v1.0

Security Headers SEO Risk Config

Audits security headers for configurations that inadvertently block crawling or break rendering.

You are a technical SEO security specialist. Review the following HTTP response headers for {domain}: {header_dump}. Identify Content-Security-Policy directives that may block Googlebot's ability to load CSS or JavaScript, X-Frame-Options settings affecting embedded content, HSTS configurations that could cause redirect issues, and missing or misconfigured headers that create both security risks and SEO problems. Produce a fix spec for each issue...
technicalsecurity-headerscrawl
GEO v1.0

Source Authority Freshness Model

Models how content freshness and domain authority jointly influence LLM source selection.

You are a GEO source authority specialist. Given the following data on competing sources for topic '{topic}': {source_data_table}, model the relationship between publish/update recency, domain authority, backlink volume, and citation frequency across LLMs. Identify the freshness threshold and authority floor required to achieve consistent LLM citation for {brand}...
geosource-authorityfreshness
Technical v1.0

Redirect 301 Consolidation Plan

Produces a redirect consolidation plan to eliminate redirect chains and loops across a site migration.

You are a redirect strategy engineer. Given the following redirect map from the site migration of {domain}: {redirect_map_csv}, identify all redirect chains longer than one hop, redirect loops, and redirect targets that themselves return a non-200 status. Produce a consolidated redirect map where every source URL points directly to its final 200-status destination in a single hop...
technicalredirectsmigration
Audit v1.0

Technical Site Crawl Audit

Runs a structured technical site audit covering crawlability, indexability, and on-page signals.

You are a technical SEO specialist. Conduct a full technical site audit for {domain}. Evaluate crawlability, indexability, response codes, redirect chains, canonical tags, and on-page signals. Output a prioritised issue list with severity ratings (critical/high/medium/low) and recommended fixes...
auditcrawltechnical
Technical v1.0

XML Sitemap Index Structure Spec

Designs a scalable XML sitemap index architecture for large sites with multiple content types.

You are a sitemap architecture specialist. Design an XML sitemap index structure for {domain} which has the following content types and estimated URL counts: {content_type_url_counts}. Specify how to split URLs across child sitemaps (by content type, locale, or priority tier), recommend lastmod update frequency per sitemap, define priority and changefreq values, and provide the sitemap index XML template...
technicalsitemaparchitecture
Ranking v1.0

Branded Query Impression Planner

Analyzes branded query impression share and plans content to increase ownership of brand SERPs.

Using the following Google Search Console branded query data for {brand_name}: {gsc_data}, identify branded queries where {site_url} does not hold position 1, analyze which competitor pages are displacing the brand, and output a SERP ownership plan including content, schema, and entity signal actions...
rankingbranded-queriesserp
Audit v1.0

Canonical Chain Conflict Detector

Finds pages where canonical tags point to non-canonical or redirecting URLs creating conflicts.

Using the crawl export for {site_url}, identify all canonical tag conflicts including: canonicals pointing to redirected URLs, canonicals pointing to noindex pages, self-referencing canonicals on paginated series, and cross-domain canonical mismatches. Output a fix specification table...
auditcanonicalcrawl
Technical v1.0

CDN Cache SEO Header Spec

Specifies Cache-Control and Vary header configurations that optimize crawl efficiency and freshness.

Design a CDN caching header configuration for {site_url} hosted on {cdn_provider}. Specify Cache-Control directives (max-age, stale-while-revalidate, stale-if-error), Vary header rules, and cache invalidation triggers optimized for Googlebot crawl efficiency, content freshness for news pages, and static asset longevity. Output the header spec and implementation code...
technicalcdncaching
GEO v1.0

ChatGPT Source Entity Readiness

Assesses whether a brand's entity signals are strong enough for ChatGPT to cite it as a source.

Evaluate the entity strength of {brand_name} as a potential ChatGPT citation source. Review the following signals: Wikipedia presence, Wikidata entry, Google Knowledge Panel attributes, high-authority backlink profile, and named author bylines. Output a readiness score and gap action plan...
geochatgptentity
Content v1.0

Content Decay Traffic Diagnosis

Diagnoses the specific cause of traffic decay for a page and prescribes a refresh action plan.

Analyze the following GSC and Analytics data for {page_url} showing a {decline_percentage}% traffic decline over {time_period}: {performance_data}. Diagnose whether the decay is caused by intent shift, SERP feature displacement, competitor content improvement, freshness loss, or technical issues. Output a prioritized refresh action plan...
contentcontent-decayrefresh
Content v1.0

Content Outline E-E-A-T Enrichment

Enhances a content outline with E-E-A-T signals including author cues, citations, and expertise markers.

Take the following content outline for {page_title}: {outline}. Enrich each section with specific E-E-A-T enhancements: recommended expert quotes to solicit, first-hand experience signals to include, authoritative external sources to cite, and author credential callouts. Output the enhanced outline with E-E-A-T annotations...
contente-e-a-toutline
Content v1.0

Content Refresh Traffic Impact Scorer

Scores a list of decaying pages by potential traffic recovery value to prioritize refresh work.

Using the following list of pages from {site_url} with their GSC impressions, clicks, average position, and last-modified dates: {page_data}, score each page for refresh priority based on: historical traffic peak, current ranking position, keyword difficulty of target terms, and content freshness gap. Output a ranked refresh queue with effort estimates...
contentcontent-refreshprioritization
GEO v1.0

Generative SERP Source Preference Map

Maps which source types generative SERPs prefer for a given topic and how to compete.

For the topic {topic}, analyze the source types (publisher, brand, academic, UGC, government) that appear most frequently in generative SERP responses across Google AI Overviews and Perplexity. Output a source preference map and recommend how {brand_name} can position content to compete...
geogenerative-serpsource-authority
Ranking v1.0

Image SERP Schema Gap Audit

Audits image pages for structured data gaps that limit image SERP rich result eligibility.

Analyze the following image page URLs from {site_url}: {url_list}. For each page, evaluate missing ImageObject schema properties, absent caption markup, unoptimized filename conventions, and missing license markup. Output a structured data enhancement spec to maximize image SERP visibility...
rankingimage-serpschema
Ranking v1.0

Knowledge Panel Gap Fixer

Identifies missing or incorrect knowledge panel attributes for a brand and plans corrections.

Review the current Google Knowledge Panel for {brand_name}. Identify missing attributes (e.g., founding date, CEO, headquarters, social profiles), incorrect information, and absent entity connections. For each gap, specify the structured data implementation, Wikipedia edit, or Wikidata addition needed to fix it...
rankingknowledge-panelentity
Audit v1.0

Log File Bot Priority Audit

Analyzes server log files to identify which bots are consuming crawl budget and on what URLs.

Analyze the following server log file excerpt for {site_url}. Segment all bot activity by user-agent, identify the top 20 URLs receiving the most Googlebot visits, flag URLs that are crawled frequently but generate no organic traffic, and recommend crawl budget reallocations...
auditlog-filecrawl-budget
Audit v1.0

Redirect Loop Chain Finder

Detects multi-hop redirect chains and loops from a provided URL list or crawl export.

Given the following redirect map for {site_url}: {redirect_csv}, identify all redirect chains exceeding 2 hops, flag any redirect loops, calculate the cumulative latency added per chain, and output a consolidation plan showing the optimal direct redirect targets...
auditredirectstechnical
Technical v1.0

SSR Hydration SEO Gap Finder

Identifies content that exists only post-hydration and is therefore invisible to search crawlers.

Compare the following server-side rendered HTML and client-side hydrated DOM for {page_url}: {ssr_html} vs {hydrated_html}. Identify all content elements (headings, body text, internal links, schema markup, meta tags) present only after hydration. Classify each by SEO impact severity and specify the SSR fix required for each...
technicalssrrendering
Audit v1.0

Technical Site Crawl Health Audit

Runs a structured diagnostic on crawl health issues across a site using provided crawl data.

You are an SEO technical auditor. Given the following crawl export data for {site_url}, identify all crawl health issues grouped by severity (critical, moderate, low), including blocked resources, redirect chains, broken links, and orphaned pages. Output a prioritized fix list in table format...
auditcrawltechnical
GEO v1.0

Brand Mention Context Profiler

Analyzes the surrounding context of brand mentions in LLM outputs to evaluate sentiment and association quality.

Collect {n} LLM-generated responses mentioning {brand_name} across the query set {query_list}. For each mention, extract the surrounding sentence, classify the sentiment (positive/neutral/negative), identify co-occurring entities, and flag any inaccurate associations. Summarize the dominant brand narrative and recommend content changes to shift it toward {desired_positioning}...
geobrand-mentionsentiment
Ranking v1.0

Branded Query Impression Gap Plan

Diagnoses why branded query impression share is below expected levels and maps recovery actions.

Using GSC data for {site_url}, extract all queries containing {brand_name}. Calculate current click-through rate, average position, and impression share by branded query type (brand only, brand + product, brand + review). Identify queries where position is below 1.5 or CTR is below {ctr_benchmark}%, diagnose likely causes, and recommend targeted on-site and off-site fixes...
rankingbranded-queriesctr
GEO v1.0

ChatGPT Entity Readiness Checker

Assesses whether a brand entity has sufficient web presence for ChatGPT to cite it accurately.

Using the brand name {brand_name}, query ChatGPT with the following prompts: {prompt_list}. For each response, record whether the brand is mentioned, the accuracy of the description, and any hallucinated attributes. Identify the entity signals (Wikipedia presence, structured data, authoritative mentions) that are missing and would improve citation accuracy...
geochatgptentity
Ranking v1.0

Cluster Opportunity Volume Scorer

Scores topic clusters by aggregate search volume, competition, and current ranking coverage to prioritize investment.

Given the topic cluster list {cluster_list} for {site_url}, for each cluster calculate: total keyword volume, average keyword difficulty, number of keywords with existing rankings in positions 1–20, and estimated traffic opportunity if positions improve to top 3. Score each cluster on a composite opportunity index and rank them to guide content investment for Q{quarter}...
rankingcluster-opportunityprioritization
Ranking v1.0

Competitor Content Ranking Gap Map

Maps keywords where competitors rank in positions 1-10 but the target site has no ranking page.

Using the keyword ranking export for {competitor_list} and {site_url}, identify all keywords where at least one competitor ranks in positions 1–10 but {site_url} has no ranking URL. Filter to keywords with monthly search volume above {min_volume}, group by topic cluster, and output a prioritized gap list with recommended content types and target URLs for each cluster...
rankingcompetitor-gapkeyword-research
Content v1.0

Content Brief Entity Depth Builder

Generates a content brief enriched with entity associations, semantic relationships, and NLP optimization cues.

Create a comprehensive content brief for a {content_type} targeting the primary keyword {primary_keyword}. Include: target audience, search intent, recommended word count, entity list with semantic relationships, required LSI terms, suggested heading structure, E-E-A-T signals to incorporate, internal link targets, and a checklist of schema markup to apply...
contententitycontent-brief
Content v1.0

Content Gap Topic Depth Map

Maps content gaps by topic depth, showing which subtopics are absent or shallowly covered on a site.

Perform a content gap analysis for {site_url} against {competitor_list} in the {niche} space. For each major topic in the {topic_taxonomy}, rate {site_url}'s coverage depth as: comprehensive, shallow, or absent. For absent and shallow topics, estimate keyword volume opportunity and output a prioritized content production roadmap for the next {n} months...
contentcontent-gaptopical-authority
Content v1.0

Content Refresh Traffic Drop Brief

Produces a targeted refresh brief for a page that has experienced significant organic traffic decline.

Using GSC data for {page_url}, identify the traffic decline period and the keywords that lost the most impressions and clicks. Analyze current on-page content against the top 3 ranking pages for the primary keyword. Produce a refresh brief covering: outdated claims to update, sections to expand, missing entities to add, schema to implement, and a revised title and meta description...
contentcontent-refreshtraffic-recovery
GEO v1.0

GEO Entity Prominence Scorer

Scores how prominently a brand entity appears in LLM-generated answers relative to competitors.

For the topic {topic}, collect LLM-generated answers from {llm_list}. Score each answer for entity prominence of {brand_name} vs. {competitor_list} using a rubric: first mention position, mention frequency, sentiment, and association with authoritative claims. Output a prominence score per LLM and a content action plan to improve the score...
geoentityprominence
Audit v1.0

Hreflang Matrix Return Tag Audit

Verifies bidirectional hreflang return tag consistency across all locale variants of a site.

Given the hreflang export for {site_url} covering locales {locale_list}, build a complete return-tag matrix. Flag any locale pair where the return tag is missing, points to a non-canonical URL, or uses an incorrect language-region code, and output a corrected hreflang set for each flagged URL...
audithreflanginternational
Audit v1.0

Image SEO Alt Coverage Audit

Audits image alt text, file names, and structured data completeness across a target URL set.

Crawl the URL set {url_list} and extract all <img> elements. For each image, report: alt attribute presence and quality, descriptiveness of the file name, whether it appears in an ImageObject schema, and whether it is included in the image sitemap. Flag the top {n} highest-traffic pages with missing or empty alt text...
auditimage-seoaccessibility
Audit v1.0

Internal Link Anchor Distribution Audit

Evaluates anchor text diversity across internal links to detect over-optimization or missed signal opportunities.

Using the internal link crawl data for {site_url}, produce a frequency table of anchor text used for each target URL. Flag URLs where more than {threshold}% of anchors are identical, highlight pages with purely generic anchors, and recommend a diversified anchor text set for the top {n} target pages...
auditinternal-linksanchor-text
Audit v1.0

JS Content Delta Render Audit

Compares raw HTML vs. rendered DOM to detect content visible only after JavaScript execution.

For each URL in {url_sample}, compare the raw HTML response against the fully rendered DOM captured via headless Chrome. List every text block, link, and structured data element present in the rendered DOM but absent from the raw HTML, and classify each as a crawlability risk: high, medium, or low...
auditjavascriptrendering
GEO v1.0

LLM Recency Content Gap Audit

Detects topics where LLM knowledge cutoffs cause outdated citations and maps freshness opportunities.

Identify {n} queries in the {niche} space where LLM responses contain outdated information due to training cutoffs. For each, document the incorrect or stale claim, the correct current information, and the content format (article, FAQ, data page) {site_url} should publish to become the fresh authoritative citation source...
georecencyfreshness
Audit v1.0

Log File Bot Segment Profiler

Segments server log entries by bot type to reveal crawl patterns and wasted crawl budget.

Given the log file export for {site_url} covering {date_range}, segment all bot requests by user agent (Googlebot, Bingbot, AhrefsBot, etc.), calculate hits per bot per day, flag URLs receiving disproportionate bot traffic, and identify pages with zero Googlebot visits...
auditlog-filecrawl-budget
Content v1.0

Meta Title CTR Variant Generator

Generates and scores multiple title tag variants optimized for click-through rate on a target SERP.

For the page at {target_url} targeting {primary_keyword} on a {intent_type} SERP, generate {n} title tag variants under 60 characters each. For each variant, score it on: keyword prominence, emotional trigger presence, uniqueness vs. current top-3 competitors, and estimated CTR improvement. Recommend the top 2 variants with rationale and an A/B test split plan...
contenttitle-tagsctr
Technical v1.0

Prerender SEO Config Decision Spec

Determines whether prerendering is appropriate for a JS-heavy site and specifies the optimal configuration.

Evaluate whether prerendering (via {prerender_service}) is the right SEO rendering solution for {site_url} given its {framework} architecture and {monthly_crawl_budget} estimated Googlebot crawl budget. Compare prerendering against SSR and dynamic rendering on: implementation cost, rendering fidelity, cache invalidation complexity, and SEO risk. If recommended, output a complete prerender configuration spec and a bot-detection rule set...
technicalprerenderingrendering
GEO v1.0

Perplexity Source Competitor Profile

Profiles which competitor domains Perplexity consistently cites for a topic area and why.

Run the following {n} queries in Perplexity and record every cited source URL. Aggregate citation frequency by root domain, identify the content attributes (format, recency, authority signals) shared by top-cited domains, and compare against {site_url} to explain why it is or isn't being cited for the topic {topic}...
geoperplexitycitation-analysis
GEO v1.0

Source Authority Signal Gap Brief

Maps the authority signals that LLMs use to prefer certain sources and identifies gaps for a target site.

Analyze the top {n} sources cited by {llm_name} for queries in the {topic} category. Extract the authority signals present on each cited page (author bylines, citations, data references, E-E-A-T signals, domain age, backlink profile). Compare against {site_url} and produce a prioritized list of authority signals to add or improve...
geosource-authoritye-e-a-t
Content v1.0

Topic Cluster Hub Page Brief

Creates a detailed brief for a cluster hub page that organizes and links to all spoke content pieces.

For the topic cluster centered on {pillar_topic}, generate a content brief for the hub page. Include: recommended title and meta description, full H2/H3 outline covering all major subtopics, internal link anchors to {n} spoke pages, entity associations to establish topical authority, word count recommendation, and FAQ schema section addressing the top {n} PAA questions for this topic...
contenttopic-clusterhub-page
Technical v1.0

Schema Markup Generator By Type

Generates complete, validated JSON-LD schema markup for a specified Schema.org type and page context.

Generate a complete JSON-LD schema markup block for a {schema_type} page at {target_url}. Use the following page data: {page_data}. Include all required properties as defined by Google's Rich Results guidelines, add recommended properties that improve rich result eligibility, and flag any properties where data is missing and a default placeholder is used...
technicalschemajson-ld
Ranking v1.0

Video SERP Schema Opportunity Finder

Finds queries where video carousels appear and maps the VideoObject schema needed to qualify.

For the keyword list {keyword_list}, identify which SERPs contain a video carousel or inline video result. For each video-present SERP, analyze the top-ranking videos' VideoObject schema properties. Compare against existing video content on {site_url}, flag missing schema properties, and output a VideoObject schema template for each video type to maximize rich result eligibility...
rankingvideo-serpschema
Technical v1.0

XML Sitemap Index Architecture Spec

Designs an optimal sitemap index structure splitting URLs by type, priority, and crawl frequency.

Design a sitemap index architecture for {site_url} containing approximately {url_count} indexable URLs. Specify how to split URLs across child sitemaps by page type ({page_types}), set appropriate lastmod and changefreq values per type, define priority weighting logic, identify URLs to exclude, and output the sitemap index XML and one example child sitemap XML...
technicalsitemapcrawl
GEO v1.0

AEO Topical Gap Authority Brief

Maps topical authority gaps that prevent a site from being selected as an AEO answer source.

For the topic {topic}, identify the top 20 subtopics that LLMs and AI Overviews cite sources for. Check {site_url}'s content coverage against each subtopic. Produce a gap brief listing uncovered subtopics, the current dominant source for each, and a content priority plan to build {site_url}'s topical authority for AEO selection...
geoaeotopical-authority
GEO v1.0

AI Overview Query Intent Fit

Scores how well a page's content matches AI Overview trigger intent for a target query set.

For each query in {query_list}, retrieve or simulate the AI Overview response and compare it against the content on {page_url}. Score alignment across: answer completeness, entity coverage, format match (list/paragraph/table), and source trust signals. Output a per-query fit score and the top content edits needed to improve AI Overview inclusion odds...
geoai-overviewintent
GEO v1.0

Brand Mention Context Diagnostic

Audits the context in which an LLM mentions a brand to detect sentiment or category misclassification.

Query ChatGPT, Claude, and Perplexity with 10 prompts about {brand_name} covering {brand_topics}. For each response record: whether the brand is mentioned, the sentiment (positive/neutral/negative), the category context used, and any factual errors. Summarize misclassification patterns and recommend content or entity-signal fixes to correct LLM brand perception...
geobrand-mentionsentiment
Ranking v1.0

Competitor Content SERP Share Gap

Measures SERP visibility share gaps between your site and competitors across a keyword cluster.

For the keyword cluster {cluster_name} containing {keyword_list}, pull current ranking positions for {your_domain} and competitors {competitor_list}. Calculate SERP visibility share (using estimated CTR weights) per domain. Identify the keywords where competitors outrank you by more than 5 positions, analyze their ranking pages' content and backlink signals, and recommend a gap-closing action plan...
rankingcompetitorvisibility
Content v1.0

Content Gap Cluster Opportunity Map

Maps content gaps across a topic cluster to reveal the highest-traffic unaddressed subtopics.

Compare the existing content inventory of {site_url} ({content_inventory_csv}) against the full topic cluster for {main_topic}. Identify subtopics with search volume above {volume_threshold} that have no matching page on the site. Cluster gaps by funnel stage and content type, estimate traffic opportunity for each, and output a prioritized content creation roadmap...
contentgap-analysiscluster
Content v1.0

Content Refresh Traffic Decay Planner

Prioritizes content refresh actions based on traffic decay rate and ranking position drift.

Analyze the content performance data for {site_url} ({performance_csv}) containing columns: URL, traffic_last_90d, traffic_prev_90d, avg_position_current, avg_position_prev, publish_date. Calculate traffic decay rate and position drift for each URL. Rank pages by composite decay score and for the top 20 decaying pages diagnose likely causes (freshness, competitors, intent shift) and recommend specific refresh actions...
contentrefreshdecay
Audit v1.0

Crawl Budget Priority Allocation

Reviews crawl budget usage and recommends directive changes to prioritize high-value page crawling.

Given the log file crawl frequency data and robots.txt for {domain}: {log_summary} and {robots_txt}, identify URL patterns consuming crawl budget without indexing value (parameter URLs, session IDs, low-traffic facets). Recommend specific Disallow rules, noindex tags, or crawl-rate adjustments to reallocate budget to priority templates...
auditcrawl-budgetrobots
Audit v1.0

Duplicate Content Parameter Cluster Audit

Finds URL parameter combinations producing duplicate or near-duplicate content clusters.

Analyze the URL parameter combinations found in the crawl of {site_url}: {parameter_url_list}. Group URLs by content similarity using the available signals (title, H1, meta description, body hash). For each duplicate cluster identify the canonical candidate, the parameter patterns causing duplication, and recommended canonical tag or URL parameter handling in GSC...
auditduplicate-contentparameters
Content v1.0

FAQ Intent Schema Content Block

Generates intent-matched FAQ content blocks with embedded FAQPage schema for a target page.

Generate a set of {faq_count} FAQ items for the page {page_url} targeting the topic {topic}. Each FAQ must: address a real user question derived from PAA or {keyword_tool} data, provide a concise answer of 40-80 words, and be formatted as valid FAQPage JSON-LD schema. Ensure questions cover navigational, informational, and comparison intent variants present in the SERP for {target_keyword}...
contentfaqschema
Ranking v1.0

Featured Snippet Format Gap Filler

Identifies the exact snippet format Google favors for target queries and rewrites content to match.

For each query in {query_list}, identify the current featured snippet holder, its format (paragraph/list/table/code), and the word count of the snippet text. Then review the corresponding section on {page_url} and rewrite it to match the winning format precisely, keeping the answer within {target_word_count} words while preserving E-E-A-T signals...
rankingfeatured-snippetcontent
GEO v1.0

GEO Content Brief Entity Density

Creates a GEO-optimized content brief focused on raising named entity density for LLM retrieval.

Build a GEO content brief for the topic {topic} targeting citation in AI-generated answers. Identify the top 15 named entities (people, organizations, concepts, places) that appear in current LLM answers on this topic. For each entity specify where and how it should be woven into {page_url}'s content, and recommend the ideal passage length and format for LLM extraction...
geoentitycontent-brief
Audit v1.0

Indexing Anomaly Root Cause Finder

Diagnoses sudden indexing drops or exclusions using GSC coverage data and site change logs.

You are an SEO diagnostician. The site {site_url} experienced an indexing drop on {date} from {before_count} to {after_count} indexed pages. Review the GSC coverage report {gsc_data} and site change log {change_log}. Identify the most probable root causes (canonical shifts, noindex deployment, crawl budget, sitemap errors) and provide a ranked diagnosis with evidence...
auditindexinggsc
Technical v1.0

JSON-LD Validation Error Repair

Diagnoses and repairs JSON-LD validation errors flagged by Google's Rich Results Test.

The following JSON-LD block from {page_url} has failed validation with these errors from the Rich Results Test: {error_list}. For each error identify the root cause (missing required property, wrong data type, invalid enum value, etc.), provide the corrected JSON-LD with the fix applied, and explain why the correction satisfies the schema.org and Google structured data guidelines...
technicaljson-ldrich-results
Ranking v1.0

Knowledge Panel Attribute Gap Mapper

Identifies missing or incorrect Knowledge Panel attributes for a brand and maps fixes to data sources.

Review the current Knowledge Panel for {brand_name} (screenshot or data: {kp_data}). List every attribute field (description, founded date, headquarters, social profiles, CEO, etc.) and flag: (a) fields that are absent, (b) fields with incorrect values, and (c) the authoritative data source (Wikidata, official site schema, Google Business Profile) that should be updated to correct each gap...
rankingknowledge-panelentity
Ranking v1.0

PAA Intent Depth Expansion

Mines People Also Ask chains to uncover second- and third-level intent questions for content expansion.

Starting with the seed query {seed_query}, extract the full PAA tree to three levels of depth using {serp_tool}. Classify each question by intent type and funnel stage. Identify which second- and third-level questions {site_url} does not currently answer, and produce a content expansion plan mapping each unanswered question to the most appropriate existing page or a new page recommendation...
rankingpaaintent
Audit v1.0

Redirect Chain Severity Classifier

Classifies redirect chains by hop count, type, and PageRank dilution risk for prioritized fixes.

Analyze the following redirect chain data exported from {tool_name} for {domain}: {redirect_data}. Classify each chain by total hop count, redirect types (301/302/meta/JS), estimated PageRank dilution, and whether the final destination is indexed. Produce a severity matrix (critical / high / medium / low) with recommended consolidation steps...
auditredirectslink-equity
Technical v1.0

Robots.txt Crawl Efficiency Spec

Writes an optimized robots.txt to block low-value URL patterns while protecting priority crawl paths.

Given the crawl data for {site_url} identifying these low-value URL patterns {url_pattern_list} and the following priority page templates {priority_templates}, write an optimized robots.txt file for the {user_agent} agents. Include Disallow rules for each low-value pattern with an inline comment explaining the rationale, a Crawl-delay directive if warranted, and a Sitemap declaration pointing to {sitemap_url}...
technicalrobots-txtcrawl-budget
Technical v1.0

Security Headers SEO CSP Spec

Writes a Content-Security-Policy header that balances security requirements with SEO rendering needs.

Write a Content-Security-Policy header for {site_url} that: allows rendering of all assets required by Googlebot (scripts, stylesheets, fonts, images from {approved_domains}), blocks unsafe-inline where possible, permits Google Tag Manager and {analytics_tool}, and does not break JavaScript-rendered content needed for SEO. Provide the full CSP directive string and a nonce-based fallback for inline scripts...
technicalsecurity-headerscsp
Content v1.0

Title Tag Keyword CTR Rewriter

Rewrites underperforming title tags to improve keyword alignment and organic CTR.

Review the following title tags and their GSC performance data for {site_url}: {title_ctr_data}. For each title with CTR below {ctr_threshold} at position {position_range}, rewrite it to: front-load the primary keyword {primary_keyword}, add a power word or number where appropriate, stay within 60 characters, and match the dominant SERP intent. Provide three variants per title with rationale...
contenttitle-tagctr
Technical v1.0

XML Sitemap Split Priority Spec

Designs a split sitemap index architecture to improve crawl prioritization for large sites.

Design a sitemap index architecture for {site_url} with approximately {total_url_count} indexable URLs across these page types: {page_type_list}. Specify how to split sitemaps by page type and priority tier, the recommended <priority> and <changefreq> values for each type, the maximum URL count per sitemap file, and the sitemap index file structure. Include the XML markup for the sitemap index and one example child sitemap...
technicalsitemapcrawl
GEO v1.0

AEO Passage Answer Quality Scorer

Scores existing content passages on answer quality dimensions that drive AEO and AI Overview inclusion.

Acting as an Answer Engine Optimization specialist, evaluate the following passages from {page_url} against these AEO quality dimensions: directness (does it answer the query in the first sentence?), completeness, factual verifiability, source attribution, and reading level. Score each passage 1–10 per dimension and output an AEO-ready rewrite for the lowest-scoring passages. Passages: {passage_list}...
geoaeopassage
GEO v1.0

AI Mode Query Cluster Builder

Maps which query clusters trigger AI Mode responses and scores the site's current content fit for each.

As a generative SERP strategist, analyze {keyword_list} and classify each query by whether it triggers an AI Mode or AI Overview response in Google. For those that do, score {domain}'s current content fit (0–10) based on passage length, specificity, schema, and corroboration. Output a prioritized optimization roadmap...
geoai-modequery-clustering
GEO v1.0

AI Overview Passage Gap Mapper

Identifies which on-page passages are most likely to be surfaced in AI Overviews for a target query set.

You are a GEO strategist. For each query in {query_list}, retrieve or simulate the AI Overview response, then map which passage from {target_url} was cited or could be cited. For uncited queries, identify the passage gap and recommend a rewrite to improve retrieval likelihood. Output a table: Query | Current Cited Passage | Gap | Recommended Passage Rewrite...
geoai-overviewpassage
GEO v1.0

Brand Mention Context Sweep

Audits the surrounding context of brand mentions across top-cited web sources to identify sentiment and topic drift.

You are a brand-GEO analyst. For {brand_name}, retrieve the top 20 web pages that LLMs are most likely to cite (using Perplexity source panels or AI Overview citations). For each page, extract the sentence-level context around the brand mention, classify sentiment (positive/neutral/negative), and identify topic associations. Summarize context drift vs. desired brand positioning...
geobrand-mentionsentiment
Content v1.0

Content Brief Intent Architecture

Builds a comprehensive content brief that maps SERP intent, competitor structure, and E-E-A-T signals for a target keyword.

You are a senior content strategist. Create a full content brief for the keyword '{target_keyword}' targeting {audience}. Include: (1) SERP intent classification and format, (2) recommended title and H1, (3) full heading outline with word-count targets per section, (4) required entities and data points, (5) E-E-A-T signals to incorporate, (6) internal and external linking recommendations...
contentbriefintent
Content v1.0

Content Decay Traffic Recovery Map

Identifies decaying content by traffic loss trend and prescribes a refresh action for each page.

You are a content performance analyst. Given the GSC traffic data for {domain} over {date_range}, identify the top 30 pages with the steepest click decline (>30% YoY drop). For each, diagnose the likely decay cause (freshness, SERP intent shift, competitor content upgrade, keyword cannibalization) and prescribe one of: full rewrite, partial update, consolidate, or deprecate. Output as a prioritized action table...
contentcontent-decayrefresh
Audit v1.0

CrUX Template CWV Breakdown

Breaks down Core Web Vitals CrUX data by page template to isolate which layouts are failing thresholds.

You are a CWV diagnostics specialist. Using the CrUX API data export for {domain}, segment LCP, INP, and CLS scores by page template (homepage, PDP, PLP, blog, landing). For each failing template, identify the most likely root cause and output a remediation table ranked by organic traffic impact. Data: {crux_data}...
auditcwvperformance
Ranking v1.0

Featured Snippet Format Matrix

Classifies target queries by featured snippet format type and maps the required content structure to win each.

Acting as a featured snippet strategist, analyze the current SERP for each query in {query_list} and classify the featured snippet format (paragraph, list, table, code, step-by-step). For each format type, specify the exact HTML structure, word count, and content pattern required for {domain} to win position zero. Output a format-to-template mapping table...
rankingfeatured-snippetserp
Audit v1.0

Hreflang Return Tag Gap Finder

Checks every hreflang pair for missing return tags and flags locale mismatches that confuse Googlebot.

You are an international SEO auditor. Given the hreflang tag export for {domain} in the format [Page URL, lang, href], verify that every referenced alternate URL contains a reciprocal return tag, flag orphaned tags, and produce a fix table with columns: Source URL, Missing Return Locale, Affected Alternate URL...
audithreflanginternational
Audit v1.0

Image SEO Alt-Title Sweep

Audits all on-page images for missing alt text, keyword alignment, and file-naming SEO signals.

Acting as an image SEO specialist, review the image inventory CSV for {domain} with columns [Page URL, Image URL, Alt Text, Title Attribute, File Size, Format]. Flag: (1) missing alt text, (2) generic filenames (img001.jpg etc.), (3) oversized images above {size_threshold_kb}KB, and (4) non-WebP/AVIF formats. Output a prioritized fix list...
auditimage-seotechnical
Content v1.0

Internal Link Anchor Recommendation

Recommends optimal anchor text for internal links pointing to target pages based on keyword and context signals.

You are an internal link strategy specialist. Given the target page {target_url} ranking for '{primary_keyword}', analyze the {linking_page_count} pages that currently link to it. For each, evaluate the existing anchor text and surrounding context. Recommend revised anchor text (exact match, partial match, or semantic variant) and the surrounding sentence edit to maximize contextual relevance without over-optimization...
contentinternal-linksanchor-text
Ranking v1.0

Keyword Cluster Cannibalization Map

Detects pages competing for the same keyword clusters and produces a consolidation or differentiation plan.

As a keyword strategy specialist, analyze the ranking data export for {domain} and identify all keyword clusters where 2+ URLs rank in positions 1–50 for the same or near-duplicate intent. For each conflict cluster, recommend: consolidate (301 + redirect), differentiate (rewrite one to a sub-intent), or preserve (genuinely different intent). Output as a prioritized action table...
rankingcannibalizationkeyword
Ranking v1.0

Knowledge Panel Attribute Gap Fix

Identifies missing or incorrect Knowledge Panel attributes for a brand and maps the signals needed to fix each.

As a Knowledge Graph optimization specialist, compare the current Google Knowledge Panel for {entity_name} against the desired attribute state: {desired_attributes}. For each missing or incorrect attribute, identify the most authoritative corroborating source (Wikipedia, Wikidata, schema.org, official site), and produce a fix brief with the exact structured data or editorial action required...
rankingknowledge-panelentity
GEO v1.0

LLM Recency Signal Gap Finder

Diagnoses why an LLM may be citing outdated information about a brand and maps freshness signal fixes.

As a GEO freshness strategist, analyze the gap between {brand_name}'s current reality and what ChatGPT, Perplexity, and Claude return when asked '{test_query}'. Identify stale facts in LLM outputs, trace likely training-data sources, and produce a freshness-signal action plan covering: press coverage, schema dateModified signals, and re-indexing triggers...
geofreshnessllm
Ranking v1.0

Local Pack Proximity Signal Audit

Analyzes local pack ranking factors for a business across geo-grid points to identify proximity and prominence gaps.

Acting as a local SEO strategist, analyze the geo-grid rank tracking data for {business_name} in {target_market} across {grid_size} grid points. Identify: (1) rank positions by distance band, (2) competitor dominance zones, (3) GBP completeness gaps vs. top-ranked competitors, (4) citation inconsistencies. Output a local prominence fix brief...
rankinglocal-seolocal-pack
Audit v1.0

Log File Segment SEO Audit

Analyzes server log segments to surface Googlebot crawl patterns, wasted budget, and missed pages.

Acting as a log-file SEO analyst, parse the server log excerpt below for {domain} and identify: (1) Googlebot crawl frequency by template type, (2) high-crawl/low-value URLs, (3) high-value URLs with zero or few crawls, and (4) crawl anomaly spikes. Log data: {log_data}...
auditlog-filecrawl-budget
Audit v1.0

Mobile-First Gap Signal Audit

Compares desktop vs. mobile-rendered HTML to surface content, link, and structured-data gaps for mobile-first indexing.

You are a mobile-first indexing specialist. Given the desktop HTML and mobile HTML snapshots for {page_url} below, diff the two and report: (1) content present on desktop but absent from mobile, (2) internal links missing from mobile, (3) structured data absent from mobile, (4) tap-target or viewport violations. Desktop: {desktop_html} Mobile: {mobile_html}...
auditmobile-firstrendering
GEO v1.0

Multi-LLM Coverage Matrix Builder

Creates a side-by-side matrix of how ChatGPT, Gemini, Claude, and Perplexity cover a brand across key queries.

You are a multi-LLM GEO analyst. For each query in {query_list}, record the response from ChatGPT-4o, Gemini 1.5 Pro, Claude 3.5, and Perplexity. Build a matrix showing: Brand Mentioned (Y/N), Citation Position, Passage Accuracy, Competitor Also Mentioned, and Sentiment. Summarize cross-LLM coverage gaps and recommended content fixes...
geomulti-llmcitation
GEO v1.0

Perplexity Source Profile Builder

Builds a citation profile for a domain by testing how often and in what contexts Perplexity cites it.

Acting as a GEO analyst, run the following 20 queries in {query_list} through Perplexity and record for each: whether {domain} was cited, the citation position (1–5), the passage snippet used, and the competing sources cited. Synthesize a citation-rate by topic cluster and recommend content improvements to increase citation frequency...
geoperplexitycitation
Technical v1.0

Prerender Config Eligibility Spec

Evaluates which page types should use prerendering and generates the configuration spec for the chosen solution.

You are a prerendering SEO architect. Evaluate the page types for {domain} ({page_type_list}) and for each determine: (1) whether prerendering is needed based on JS-dependency of SEO-critical content, (2) the recommended prerendering approach (Prerender.io, Rendertron, SSG, ISR, or native SSR), (3) cache TTL and invalidation triggers, (4) bot-detection logic to serve prerendered HTML only to crawlers. Output as a decision matrix + config spec...
technicalprerenderrendering
Technical v1.0

Robots.txt Crawl Policy Builder

Generates a robots.txt file tailored to a site's crawl budget priorities and known bot behaviors.

As a technical SEO engineer, generate a robots.txt file for {domain} given the following site structure and crawl priorities: {site_structure}. Apply these rules: (1) block known crawl-waste paths ({block_paths}), (2) allow Googlebot full access to revenue pages, (3) configure separate rules for GPTBot, PerplexityBot, and ClaudeBot per {ai_crawler_policy}, (4) include sitemap references...
technicalrobots-txtcrawl-budget
Technical v1.0

Schema Markup Property Generator

Generates complete JSON-LD markup for a specified schema type with all required and recommended properties.

You are a structured data engineer. Generate a complete JSON-LD block for the schema type '{schema_type}' for the following entity: {entity_details}. Include all required properties, all recommended properties, and any nested types needed. Validate the output against Schema.org and Google's rich result requirements. Flag any property values that require editorial review...
technicalschemajson-ld
Content v1.0

Schema-Rich How-To Block Builder

Drafts a step-by-step how-to content section with embedded HowTo schema ready for Google rich results.

Acting as a structured content author, write a how-to guide for '{how_to_topic}' with exactly {step_count} steps. Each step must: start with an action verb, be 40–80 words, include a tool or tip where relevant, and map to a HowTo Step schema property. After the content, output the complete HowTo JSON-LD block with name, description, totalTime, estimatedCost, and all steps...
contenthow-toschema
Audit v1.0

Schema Type Gap Audit

Identifies missing or misconfigured schema types across page templates and maps them to rich-result eligibility.

You are a structured-data auditor. Review the list of page templates for {site_name} below and for each template: (1) identify which Schema.org types are present, (2) flag missing types eligible for rich results, (3) note required vs. recommended properties that are absent. Templates: {template_list}...
auditschemarich-results
GEO v1.0

Source Authority Signal Brief

Outlines the authority signals a page must demonstrate for LLMs to prefer it as a cited source.

Acting as a GEO authority strategist, evaluate {page_url} against the source-selection heuristics used by large language models (author credentials, citation density, domain authority, content specificity, corroborating sources). Produce a brief with current score per signal, benchmark against top 3 cited competitors, and a 90-day authority uplift plan...
geoauthoritysource-selection
GEO v1.0

AEO Question Coverage Depth Brief

Audits how completely a site answers the question hierarchy around a topic for AEO/GEO visibility.

For the primary topic {topic}, generate a three-level question hierarchy: primary questions (5), secondary follow-up questions per primary (3 each), and tertiary clarifying questions (2 per secondary). Then evaluate each question against the content on {domain}: is it answered (yes/partial/no), answer quality score (1–5), and recommended content action. Prioritize unanswered questions with highest search demand...
geoaeoquestion-coverage
GEO v1.0

AI Overview Competitor Citation Map

Maps which competitor pages are cited in AI Overviews for your target keywords and why.

For each keyword in {keyword_list}, record the AI Overview response text and all cited URLs from Google Search. Identify every cited competitor domain, their cited page type (blog, product, study, tool), and the passage quoted or paraphrased. Then compare cited content attributes against the equivalent {domain} page and output a prioritized brief for closing the citation gap on each keyword...
geoai-overviewcompetitor
GEO v1.0

AI Overview Passage Density Scorer

Scores how densely a page's passages answer target queries to predict AI Overview inclusion likelihood.

Analyze the page content provided for {url} against the target queries: {query_list}. For each query, identify the best-matching passage, score its answer density (0–10) based on: directness, specificity, completeness, and supporting evidence. Then rank queries by inclusion likelihood in an AI Overview and suggest specific passage rewrites to improve the lowest-scoring passages...
geoai-overviewpassages
GEO v1.0

Brand Mention Context Quality Audit

Evaluates the semantic context surrounding brand mentions in LLM outputs for association quality.

Collect 20 LLM responses from {llm_name} that mention {brand} for queries in {topic_area}. For each mention, extract the surrounding 2 sentences and score: attribute associations present (list), sentiment (1–5), topical relevance to {brand}'s core offering (1–5), and whether the mention is primary or secondary. Aggregate scores and flag the weakest context patterns with content remediation suggestions...
geobrand-mentioncontext
Ranking v1.0

Branded Query Intent Segmentation

Segments branded keyword traffic by intent type to optimize landing pages and conversion paths.

Analyze the branded keyword list for {domain} exported from GSC. Classify each branded query into intent categories: navigational (direct brand lookup), informational (brand + topic), transactional (brand + product/buy/price), and review-intent (brand + reviews/vs/alternatives). For each category, identify the current landing page, its conversion optimization gap, and a recommended page or CTA improvement...
rankingbrandedintent
GEO v1.0

ChatGPT Source Freshness Audit

Audits whether ChatGPT with Browse cites recent vs. stale sources for target queries.

Using ChatGPT with Browse enabled, run each query in {query_list} and record every cited source URL and its publication date. Calculate the average source age in days per query. Flag queries where the average cited source is older than {staleness_threshold} days. For those queries, identify what fresher content {domain} could publish to displace stale citations...
geochatgptfreshness
Ranking v1.0

Competitor SERP Share Gap Analysis

Quantifies keyword-level SERP share lost to each named competitor and surfaces win-back opportunities.

Using the keyword ranking data provided for {domain} and competitors {competitor_list}, calculate for each keyword: {domain} current position, top competitor position, estimated traffic share delta, and keyword intent type. Group keywords where a competitor outranks {domain} by 5+ positions. For the top 20 gaps by traffic opportunity, diagnose the likely ranking factor gap and recommend a specific action...
rankingcompetitorgap-analysis
Content v1.0

Content Brief Competitor Angle Matrix

Generates a content brief showing which unique angles competitors cover and which gaps remain.

Analyze the top 10 ranking pages for the target keyword {target_keyword}. For each competitor page, extract the primary angle, unique data points cited, content format, word count, and H2 structure. Identify angles covered by 3+ competitors (table stakes) and angles covered by only 1 or absent entirely (differentiation opportunities). Produce a content brief for {domain} that leads with the highest-opportunity uncovered angle...
contentbriefcompetitor
Content v1.0

Content Decay Traffic Segment Triage

Segments decaying pages by decay cause type so each gets the correct refresh intervention.

Given the list of pages on {domain} that have lost 20%+ organic traffic in the last 6 months (from GSC), diagnose each page's decay type: (A) SERP intent shift, (B) competitor content improvement, (C) content staleness/outdated facts, (D) technical issues (crawl/index/CWV), or (E) keyword demand decline. For each page, output the decay type, evidence, and a tailored refresh action plan specific to that decay type...
contentcontent-decayrefresh
Content v1.0

Content Gap SERP Intent Fill Brief

Identifies content gaps by SERP intent type and creates briefs to fill each unaddressed intent.

Compare the current content inventory of {domain} against the SERP results for {keyword_cluster}. For each distinct intent type present in SERPs (informational, commercial, transactional, navigational) that {domain} does not have a strong page targeting, output: missing intent type, example ranking URL from a competitor, recommended content format, target keyword, and a 200-word content brief...
contentgap-analysisintent
Content v1.0

E-E-A-T Author Bio Schema Brief

Creates author bio content and Person schema markup to strengthen E-E-A-T signals for key authors.

For author {author_name} on {domain}, draft an optimized author bio (150–200 words) that highlights: first-hand experience with {topic_area}, formal credentials or certifications, notable publications or mentions, and years of expertise. Then generate the corresponding Person schema JSON-LD including: name, url, sameAs (LinkedIn, Twitter, Google Scholar), jobTitle, and knowsAbout. Ensure the bio and schema reinforce the same expertise claims...
contente-e-a-tauthor
Content v1.0

FAQ Question Intent Depth Generator

Generates a multi-layer FAQ set covering beginner to advanced intent for a target topic.

For the topic {topic} on {domain}, generate a structured FAQ set with three expertise tiers: beginner (5 questions), intermediate (5 questions), and advanced (5 questions). For each question, write: the question in natural conversational language, a direct answer (50–80 words), a schema-ready short answer (25 words max), and an internal link recommendation to a supporting page on {domain}. Ensure questions match PAA and GSC query data provided...
contentfaqschema
Ranking v1.0

Featured Snippet Format Gap Map

Identifies which snippet formats competitors win that your pages could capture with format changes.

For each keyword in {keyword_list} that currently shows a featured snippet, record: the snippet format (paragraph, list, table, code), the domain currently owning it, and the format used by the {domain} page targeting that keyword. Where {domain}'s format mismatches the winning snippet format, output a reformatting recommendation specifying exact HTML structure changes needed...
rankingfeatured-snippetformat
GEO v1.0

GEO Source Authority Scoring Model

Builds a scoring rubric to predict which signals make a source authoritative for LLM citation.

Using the list of sources cited by {llm_name} for queries in the topic area of {topic}, extract the following signals for each cited domain: domain authority, average content length, presence of original research, author credentials, external backlinks to cited page, and publication recency. Build a weighted scoring model that predicts citation likelihood, and apply it to score {domain} pages against top cited competitors...
geoauthoritycitation
Audit v1.0

Hreflang Return Tag Gap Check

Checks every hreflang pair to ensure reciprocal return tags exist on all referenced locale pages.

Using the hreflang tag data exported from a crawl of {domain}, verify that every hreflang annotation has a valid reciprocal return tag on the target locale page. Output a table with columns: source URL, target locale, target URL, return tag present (yes/no), error type (missing return tag, mismatched URL, wrong locale code). Prioritize errors on pages with the highest organic traffic...
audithreflanginternational
Audit v1.0

Image SEO Alt Coverage Sweep

Audits all images across a site for missing, duplicate, or keyword-poor alt text attributes.

Review the image inventory exported from a crawl of {domain} below. For each image, evaluate: presence of alt text (yes/no), alt text character length, keyword relevance score against the page's primary target keyword (0–10), and whether the alt text is duplicated across more than 3 images. Output a prioritized fix list sorted by page traffic × issue severity...
auditimage-seoaccessibility
Ranking v1.0

Image SERP Indexing Eligibility Audit

Checks image pages and metadata for signals needed to rank in Google Image Search results.

Review the image URLs provided for {domain} and evaluate each for Google Image Search eligibility: image file name keyword inclusion, alt text relevance, surrounding text context, structured data (ImageObject schema), page index status, and mobile-friendliness of the host page. Score each image 0–100 and output a prioritized fix list for images on pages with the highest existing organic traffic...
rankingimage-serpindexing
Audit v1.0

Internal Link Depth Distribution Review

Measures how many clicks from the homepage each indexed URL sits and surfaces deep-buried pages.

Using the internal link graph data provided for {domain}, calculate the click depth (shortest path from homepage) for every crawled URL. Produce a distribution table showing the number of URLs at each depth level (1–10+). Flag all URLs at depth 5 or greater that also have organic impressions above {impressions_threshold} in GSC, and suggest the shortest re-linking path to reduce their depth...
auditinternal-linkscrawl
Technical v1.0

JSON-LD FAQ Schema Validator Brief

Generates and validates FAQ JSON-LD blocks against Google's rich result requirements.

Given the following FAQ content for {url}: {faq_list}, generate a valid FAQPage JSON-LD block. Then validate it against Google's rich result requirements: check that each Question has a unique acceptedAnswer, that no answer exceeds 1500 characters, that the JSON-LD is placed in the <head> or before </body>, and that the containing page is indexable. Output the final JSON-LD and a validation checklist...
technicalschemajson-ld
GEO v1.0

LLM Entity Salience Gap Finder

Finds entity associations a brand lacks in LLM outputs compared to cited competitors.

Query {llm_name} with the following brand comparison prompts: {prompt_list}. Record every named entity (people, products, attributes, use cases) associated with {brand} versus {competitor_brands}. Identify entities strongly associated with competitors but absent or weakly associated with {brand}. For each gap entity, propose a content or PR action to build that association...
geoentitiesbrand
Ranking v1.0

Local Pack Review Signal Audit

Analyzes review count, recency, and sentiment signals affecting local pack ranking for target locations.

For each location in {location_list}, pull the top 3 local pack results for the query {target_query}. Compare {brand}'s Google Business Profile against the top 3 on: total review count, average rating, reviews in the last 90 days, owner response rate, and sentiment theme frequency (service, price, speed, quality). Output a gap table and a ranked list of review acquisition and response actions...
rankinglocal-packreviews
Audit v1.0

Log File Crawl Frequency Analysis

Parses server log data to surface over-crawled and under-crawled URL segments.

Analyze the server log excerpt below for {domain} and segment all Googlebot requests by URL path prefix. For each segment, calculate: total crawl hits, unique URLs crawled, average crawl frequency per URL, and crawl-to-index ratio. Flag segments where crawl frequency exceeds 5× per day as over-crawled and segments with fewer than 1 crawl per 30 days as under-crawled...
auditlog-filecrawl-budget
Audit v1.0

Mobile-First Indexing Content Parity Check

Compares desktop vs. mobile-rendered HTML to detect content, links, or schema missing on mobile.

Compare the desktop-rendered HTML and mobile-rendered HTML outputs provided for the following URLs on {domain}: {url_list}. For each URL, identify: text content present on desktop but absent on mobile, internal links present on desktop but absent on mobile, structured data blocks present on desktop but absent on mobile, and any mobile-specific elements that may trigger a mobile usability issue in GSC...
auditmobile-firstrendering
GEO v1.0

Multi-LLM Brand Coverage Matrix

Tests brand mention presence and framing across ChatGPT, Claude, Gemini, and Perplexity simultaneously.

Run the following brand query set: {query_list} across ChatGPT, Claude, Gemini, and Perplexity. For each query × LLM combination, record: whether {brand} is mentioned (yes/no), the sentiment framing (positive/neutral/negative), the position in the response (first mention, supporting mention, absent), and any competitor mentioned instead. Output a matrix and highlight the highest-gap LLM × query combinations...
geomulti-llmbrand
Audit v1.0

Orphan Page Crawl Gap Audit

Identifies orphaned pages receiving no internal links so they can be re-integrated or removed.

Given the following list of URLs from an XML sitemap and a crawl of internal links for {domain}, identify every URL that appears in the sitemap but receives zero internal links. For each orphan page, output: URL, estimated monthly impressions (from GSC data provided), suggested action (re-link, consolidate, or remove), and the most logical parent page to link from...
auditorphan-pagescrawl
Ranking v1.0

PAA Question Intent Cluster Builder

Mines People Also Ask questions to build intent-grouped content clusters with ranking targets.

For the seed keyword {seed_keyword}, extract all first-, second-, and third-level People Also Ask expansions from Google SERPs. Deduplicate and cluster questions by intent type (definitional, comparative, how-to, troubleshooting, transactional). For each cluster, identify the current {domain} page that best addresses it (if any), gaps where no page exists, and recommended content to fill each gap...
rankingpaaintent-clustering
GEO v1.0

Perplexity Cited Competitor Gap

Identifies which competitor domains Perplexity cites for target queries so you can close authority gaps.

For each of the following queries: {query_list}, I will provide the Perplexity.ai answer and its cited sources. Analyze which domains are cited most frequently, what content types (articles, tools, studies) are preferred, and what topical angles those sources cover that {domain} does not. Output a gap table: query, top cited competitor, cited content type, missing angle on {domain}, recommended content action...
geoperplexitycitation-gap
Content v1.0

Programmatic SEO Entity Page Template

Designs a scalable programmatic page template for entity-based content with unique value per page.

Design a programmatic content template for {page_type} pages on {domain} targeting the pattern {url_pattern}. The template must include: a dynamic H1 formula, a unique data-driven introductory paragraph using {data_source} fields, at least 3 dynamically populated content modules (e.g., stats table, related entities, FAQs), internal link logic rules, and JSON-LD schema type. Ensure no two pages will be flagged as thin or duplicate content...
contentprogrammatictemplate
Audit v1.0

Redirect Chain Consolidation Map

Maps multi-hop redirect chains and outputs direct replacement rules to eliminate unnecessary hops.

Given the following list of redirect rules for {domain}, trace every redirect chain longer than one hop. For each chain, output: the original URL, each intermediate URL, the final destination URL, total hop count, estimated PageRank dilution risk (high/medium/low), and a recommended single-hop replacement rule. Group chains by source URL prefix and sort by hop count descending...
auditredirectscrawl
Technical v1.0

Robots.txt Crawl Path Optimizer

Audits and rewrites robots.txt to maximize crawl efficiency for strategic page groups.

Review the current robots.txt for {domain} provided below and compare it against the crawl log data showing which paths Googlebot is crawling. Identify: paths that are blocked but should be crawled, paths that are crawled but should be blocked, overly broad wildcard rules causing unintended blocks, and missing Crawl-delay or sitemap directives. Output a rewritten robots.txt with inline comments explaining each rule change...
technicalrobots-txtcrawl
Audit v1.0

Schema Markup Type Coverage Check

Maps which schema.org types are implemented across site templates and flags gaps vs. competitors.

Review the list of page templates and their current JSON-LD schema implementations for {domain} provided below. For each template, identify: schema types currently present, schema types used by the top 3 ranking competitors (from the competitor data provided), gap types missing, and implementation priority (high/medium/low) based on rich result eligibility...
auditschemarich-results
Content v1.0

Schema-Rich Comparison Content Drafter

Drafts comparison content with embedded schema markup optimized for rich results and AI citation.

Draft a comparison article for {topic} comparing {option_a} vs {option_b} targeting the keyword {target_keyword}. Structure the content with: an executive summary table (with ItemList schema), individual evaluation sections using consistent criteria ({criteria_list}), a verdict section with a direct recommendation, and FAQ schema for the 5 most common comparison questions. Include JSON-LD for the article, breadcrumbs, and FAQ blocks...
contentschemacomparison
Technical v1.0

Server-Side Rendering SEO Gap Fixer

Identifies SEO-critical content rendered client-side and builds an SSR migration plan for those elements.

Compare the raw HTML response and the JavaScript-rendered DOM for the following URLs on {domain}: {url_list}. Identify elements present only in the rendered DOM (not in raw HTML): title tags, meta descriptions, canonical tags, H1s, structured data, internal links, and body content paragraphs. For each missing element type, specify the SSR or pre-rendering implementation required and estimate the indexing impact of each gap...
technicalssrrendering
Technical v1.0

Sitemap Index Split Architecture Spec

Designs a sitemap index architecture for large sites splitting by content type and priority tier.

Design a sitemap index structure for {domain} with approximately {total_url_count} indexable URLs. Split child sitemaps by: content type ({content_types}), crawl priority tier (tier 1: top-revenue pages; tier 2: supporting content; tier 3: archival), and locale ({locale_list}). For each child sitemap, specify: filename, URL inclusion logic, lastmod update frequency, and priority values. Output the sitemap index XML and a governance document...
technicalsitemaparchitecture
Content v1.0

Title Tag Emotional Trigger Optimizer

Rewrites title tags using emotional and curiosity triggers to improve click-through rates from SERPs.

For each page URL in {url_list} on {domain}, I will provide the current title tag, target keyword, and average CTR from GSC. Rewrite each title tag to: include the target keyword within the first 40 characters, add one emotional or curiosity trigger word (e.g., proven, secret, exact, surprising), stay within 60 characters, and maintain search intent alignment. Output original vs. rewritten title with rationale for each change...
contenttitle-tagctr
Content v1.0

Topic Cluster Spoke Content Calendar

Converts a topic cluster architecture into a sequenced content production calendar with priorities.

Given the topic cluster map for {pillar_topic} with hub page and spoke topics {spoke_list}, create a 90-day content production calendar. For each spoke, specify: target keyword, search volume, content format, estimated word count, internal link targets, target publish date (sequenced to build topical authority progressively), and success metric. Prioritize spokes by: existing ranking gap × search volume × production effort score...
contenttopic-clustercalendar
Ranking v1.0

Video SERP Schema Eligibility Check

Audits video pages for VideoObject schema completeness to qualify for video rich results in SERPs.

For each video page URL in {url_list} on {domain}, check the following VideoObject schema properties: name, description, thumbnailUrl, uploadDate, duration, contentUrl or embedUrl, and publisher. Flag missing or malformed properties, validate thumbnail URL accessibility, and verify that the page is indexable. Output a per-URL fix table ranked by estimated video SERP traffic opportunity...
rankingvideo-serpschema
GEO v1.0

AEO Question Format Optimizer

Restructures content into answer-engine-optimized formats to maximize direct answer retrieval.

For the following content excerpt from {url}: {content_excerpt}, identify all implicit answers to user questions. Rewrite each into an explicit Q&A format with a concise direct answer (≤50 words) followed by supporting detail, optimized for retrieval by answer engines and LLMs...
geoaeocontent-format
GEO v1.0

AI Mode Query Cluster Visibility

Identifies which topic clusters your site is visible in within Google AI Mode responses.

For the topic cluster {cluster_topic}, test the following seed queries {queries} in Google AI Mode. Document which URLs from {our_domain} appear as cited sources, which competitor domains dominate, and which sub-topics represent zero-presence opportunities for {brand_name}...
geoai-modevisibility
GEO v1.0

AI Overview Passage Freshness Scorer

Scores content passages for freshness signals that increase likelihood of AI Overview inclusion.

Review the following content passages from {url} and score each on a 1–10 freshness signal scale based on: publication/update date visibility, presence of current statistics, named recent events, and recency language cues. Recommend specific edits to improve each score...
geoai-overviewfreshness
GEO v1.0

Brand Mention Context Signal Brief

Analyzes the context in which a brand is mentioned online to improve LLM citation relevance.

Collect the top 30 web mentions of {brand_name} from the past 90 days. For each, classify the mention context (product review, news, directory, editorial), sentiment, and co-occurring entities. Identify the context types most correlated with LLM citation and recommend a content seeding strategy...
geobrand-mentioncitation
Ranking v1.0

Branded Query Intent Segmenter

Segments branded keyword queries by intent type to expose reputation and navigation gaps.

Analyze the following branded keyword list for {brand_name}: {keyword_list}. Classify each query by intent (navigational, informational, transactional, reputational). For any intent segment with weak SERP ownership by {site_url}, recommend page types or content assets to capture that segment...
rankingbrandedintent
Technical v1.0

CDN Cache Control SEO Audit

Audits CDN cache-control headers to identify settings that harm crawlability or freshness signals.

Review the following CDN cache-control header responses for key URL types on {site_url}: {header_samples}. Identify: (1) pages cached too aggressively causing stale content for Googlebot, (2) dynamic pages missing cache directives, (3) Vary header misconfigurations, and (4) ETag implementation gaps. Provide corrected header values...
technicalcdncaching
Ranking v1.0

Cluster Gap Opportunity Sizer

Quantifies the traffic opportunity of unaddressed topic cluster gaps vs existing content coverage.

Using the topic cluster map for {cluster_theme} and the current content inventory of {site_url}, identify sub-topics with no existing page coverage. For each gap, estimate monthly search volume, keyword difficulty, and projected traffic opportunity if a new page ranked in position 1–3...
rankingclusteropportunity
Content v1.0

Content Gap Competitor Coverage Map

Maps subtopics covered by top competitors but absent from your site to prioritize content creation.

Compare the content inventory of {site_url} against the top 3 competitors {competitor_urls} for the topic area {topic}. Identify subtopics and keywords each competitor ranks for that {site_url} does not cover. Cluster gaps by opportunity size (volume × difficulty) and output a prioritized content creation backlog...
contentgap-analysiscompetitor
Content v1.0

Content Outline FAQ Schema Block

Generates a content outline with embedded FAQ schema blocks for rich result eligibility.

For the target keyword {keyword}, produce a full content outline including: H1, H2/H3 structure, recommended word count per section, and a FAQ section with 5–8 Q&A pairs. Format the FAQ section as valid JSON-LD FAQPage schema ready to embed in {target_url}...
contentfaqschema
Content v1.0

E-E-A-T Author Signal Brief

Builds a targeted brief for strengthening author E-E-A-T signals on a specific content piece.

Review the existing content at {url} and the author bio for {author_name}. Identify gaps in experience, expertise, authoritativeness, and trustworthiness signals. Produce a specific brief covering: bio edits, credential citations, first-hand experience additions, and external authority links to add...
contente-e-a-tauthor
Ranking v1.0

Featured Snippet Table Format Targeter

Identifies queries returning table-format featured snippets and builds content specs to win them.

For the following keyword list {keywords}, identify which queries currently trigger table-format featured snippets in Google. For each, extract the table structure (rows, columns, data type) from the current winner and produce a content spec for {our_domain} to build a competing table...
rankingfeatured-snippetserp
GEO v1.0

Generative SERP Source Gap Map

Maps which sources dominate generative SERP features and surfaces gaps for your domain.

For the following informational query set {queries}, record the sources cited in Google AI Overviews and Perplexity answers. Build a source frequency table and identify: (1) domains consistently cited that {our_domain} competes with, (2) content formats driving citations, and (3) zero-presence queries to target first...
geogenerative-serpgap-analysis
Audit v1.0

Image SEO Alt Format Audit

Audits image alt text, file formats, and lazy-load implementation for SEO compliance across a page set.

For the following list of URLs from {site_url}, audit every image for: (1) missing or keyword-stuffed alt text, (2) unoptimized file formats (e.g., JPEG instead of WebP/AVIF), (3) missing width/height attributes causing CLS, and (4) lazy-loading applied above-the-fold. Output a prioritized fix table...
auditimagescore-web-vitals
Technical v1.0

INP Interaction Trace Root Fix

Traces the root cause of poor INP scores to specific interaction events and proposes code-level fixes.

Analyze the following INP interaction trace data from Chrome DevTools for {url}: {trace_data}. Identify the specific interaction event(s) exceeding 200ms, the JavaScript task(s) causing input delay or processing delay, and any long rendering updates. Provide actionable code-level recommendations to bring INP below the 'Good' threshold...
technicalinpcore-web-vitals
Ranking v1.0

Knowledge Panel Attribute Gap

Identifies missing or incorrect Knowledge Panel attributes and maps the sources that control them.

Review the current Google Knowledge Panel for {entity_name}. List every attribute field (description, founding date, headquarters, social profiles, etc.), whether it is populated or missing, the likely data source controlling each field, and a recommended action to add or correct each attribute...
rankingknowledge-panelentity
Audit v1.0

Mobile First Content Parity Checker

Compares desktop vs mobile rendered HTML to surface content stripped from the mobile version.

Compare the desktop and mobile rendered HTML outputs below for {url}. Identify any headings, body text, structured data, or internal links present on desktop but absent from the mobile render. Flag each discrepancy with its SEO risk severity...
auditmobile-firstrendering
GEO v1.0

Multi LLM Answer Drift Tracker

Tracks how brand mentions and citations shift across multiple LLMs over time for a query set.

For the query set {queries}, record the responses from {llm_list} on {date}. Compare brand mention frequency, citation position, and sentiment for {brand_name} against the previous snapshot. Flag queries with negative drift and recommend corrective content actions...
geollmbrand-mention
Ranking v1.0

News SERP Topical Authority Plan

Builds a publishing cadence plan to establish topical authority for News SERP inclusion.

For {publisher_domain} targeting news SERP visibility on the topic {topic}, analyze: current Google News inclusion status, publishing frequency vs competitors, byline E-E-A-T signals, and freshness patterns. Produce a 30-day publishing cadence plan with recommended article formats and schema requirements...
rankingnews-serptopical-authority
GEO v1.0

Perplexity Competitor Citation Gap

Identifies which competitors Perplexity cites for target queries and maps gaps vs your domain.

For the following list of target queries: {queries}, run a Perplexity citation analysis and identify which domains are cited, how frequently, and in what context. Compare against {our_domain} and flag queries where we are absent but competitors {competitor_domains} appear...
geoperplexitycitation
Technical v1.0

Prerender SEO Config Validator

Validates prerendering configuration to confirm bots receive fully rendered SEO content.

Review the prerendering configuration for {site_url} using the following setup details: {config_details}. Verify: (1) bot user-agent detection logic is accurate and up to date, (2) prerendered HTML contains all critical SEO elements, (3) prerender cache TTL is appropriate for content update frequency, and (4) no cloaking risk exists. Flag any compliance issues...
technicalprerenderrendering
Content v1.0

Programmatic Content Template Validator

Validates programmatic page templates for thin content risk and differentiation signals.

Review the following programmatic page template used to generate {page_count} pages on {site_url}: {template_html}. Assess: (1) thin content risk per Google's quality guidelines, (2) unique value differentiation between rendered instances, (3) missing structured data, and (4) internal linking logic. Recommend template improvements...
contentprogrammaticthin-content
Technical v1.0

Security Headers SEO Risk Brief

Evaluates security headers for configurations that block crawling, rendering, or indexing.

Review the following HTTP response headers for {site_url}: {headers}. Identify any security header configurations that may negatively impact SEO, including: CSP directives blocking inline scripts required for structured data, X-Frame-Options preventing iframing, HSTS misconfigurations, and missing or overly restrictive Permissions-Policy values. Provide corrected header configs...
technicalsecurity-headerscrawling
Ranking v1.0

SERP Volatility Cause Matrix

Correlates ranking fluctuation events with algorithm updates, content changes, and competitor moves.

Given the ranking history data below for {tracked_keywords} on {site_url}, identify periods of significant volatility (±5 positions). For each volatility window, correlate the timing with: known Google algorithm updates, {site_url} content changes, and competitor SERP entries. Output a cause probability matrix...
rankingvolatilityalgorithm
Technical v1.0

Server Side Rendering SEO Config

Defines SSR configuration requirements to ensure full SEO content delivery to crawlers.

For the {framework} application at {site_url}, define an SSR configuration that ensures: (1) all critical SEO elements (title, meta, h1, canonical, structured data) are rendered server-side, (2) dynamic routes are pre-rendered or SSR'd, (3) hydration does not strip or alter server-rendered content. Output config file snippets with explanations...
technicalssrrendering
Content v1.0

Title Tag SERP CTR Rewrite Batch

Rewrites underperforming title tags to improve expected CTR based on SERP position and intent.

For the following pages on {site_url} with CTR below {ctr_threshold}%: {url_list}, rewrite each title tag to: stay within 55–60 characters, front-load the primary keyword, match the dominant SERP intent, include a CTR-boosting modifier where natural, and avoid truncation on mobile. Output as a table of old vs new titles...
contenttitle-tagctr
Content v1.0

Topic Cluster Hub Content Spec

Produces a detailed content specification for a topic cluster hub (pillar) page.

Create a detailed content specification for a hub/pillar page targeting the topic cluster {cluster_topic} on {site_url}. Include: target keyword and semantic variants, recommended page structure, spoke page link targets with anchor text, word count, schema type, and E-E-A-T requirements...
contentclusterpillar
Content v1.0

Anchor Text Diversity Gap Fixer

Analyzes internal anchor text distribution for a target page and produces a diversified anchor text plan.

Review all internal links pointing to {target_page_url} on {your_domain}: {internal_link_anchor_list}. Calculate the anchor text distribution (exact match, partial match, branded, generic, URL). Flag over-optimized patterns and produce a diversified anchor text replacement plan for the top 20 internal links by PageRank proximity...
contentanchor-textinternal-links
Ranking v1.0

Branded Query SERP Defense Audit

Audits the branded SERP for competitor intrusions, negative content, and knowledge panel gaps.

Analyze the current SERP for {brand_name} and its top 10 branded query variants: {branded_query_list}. Document: (1) competitor ads or organic results appearing, (2) negative or off-brand content in top 10, (3) sitelinks presence and quality, (4) knowledge panel completeness. Output a ranked defense action list...
rankingbranded-serpbrand
GEO v1.0

Claude Citation Readiness Scorecard

Scores a content page's readiness to be cited by Claude based on Anthropic's known source preference signals.

Evaluate the following page {page_url} targeting {target_query} for its Claude citation readiness. Score it across: factual grounding, hedging language quality, citation of primary sources, passage-level clarity, and structural retrievability. Produce a scorecard with weighted scores and priority fixes...
geoclaudecitation-readiness
GEO v1.0

ChatGPT Source Eligibility Scorer

Scores a content asset's likelihood of being selected as a ChatGPT source for a given topic.

Evaluate the following content page {page_url} for its eligibility to be cited by ChatGPT when users ask about {topic}. Score it across: source authority signals, factual specificity, recency, entity prominence, and passage retrievability. Provide a weighted score and top 3 improvement actions...
geochatgptsource-eligibility
Technical v1.0

Cloudflare Worker SEO Header Rules

Writes a Cloudflare Worker script that injects SEO-critical HTTP headers at the edge without origin changes.

Write a Cloudflare Worker script for {site_url} that injects the following HTTP headers on all HTML responses: {header_rules_list}. The script must: add canonical headers where missing, inject X-Robots-Tag directives for specified URL patterns, add Link rel=preload headers for LCP resources, and set correct Cache-Control headers for static assets...
technicalcloudflareedge-seo
Ranking v1.0

Competitor SERP Feature Gap Map

Maps every SERP feature a competitor owns that your domain does not, ranked by traffic opportunity.

For the following list of competitor domains: {competitor_list}, identify all SERP features they currently own (featured snippets, PAA boxes, knowledge panels, image packs, video carousels, local packs) for keywords also targeted by {your_domain}. Rank each feature gap by estimated monthly traffic opportunity...
rankingcompetitor-gapserp-features
Content v1.0

Content Brief Topical Gap Builder

Generates a full content brief that fills a specific topical gap identified from SERP competitor analysis.

Create a detailed content brief for a page targeting {primary_keyword} on {your_domain}. Based on the following gap analysis data from top-ranking competitors: {gap_data}, the brief must include: target intent, required subtopics, recommended content format, E-E-A-T signals to include, word count range, and internal linking targets...
contentbriefgap-analysis
Content v1.0

Content Decay SERP Rank Diagnosis

Diagnoses the root causes of traffic decay for a specific page by comparing it against current SERP winners.

Analyze the traffic and ranking history for {page_url} targeting {primary_keyword}: {performance_data}. Compare the page's current content against the top 3 current ranking pages. Identify: (1) intent drift since publication, (2) content freshness gaps, (3) missing entities or subtopics, (4) format mismatches. Produce a root cause diagnosis and prioritized fix list...
contentcontent-decaydiagnosis
Content v1.0

Content Refresh Impact Scorer

Scores a list of decaying content pages by expected traffic recovery potential after a refresh.

Evaluate the following list of content pages on {your_domain} that have experienced traffic decline: {page_list}. For each page, score its refresh priority (1-10) based on: current ranking position, historical peak traffic, keyword difficulty, content age, and competitor freshness. Output a ranked refresh schedule with recommended update actions per page...
contentcontent-refreshdecay
Audit v1.0

Core Web Vitals CrUX Segment Review

Compares CrUX field data across device and connection segments to pinpoint underperforming cohorts.

Analyze the following CrUX field data export for {site_url}: {crux_data}. Break down LCP, INP, and CLS scores by device type (mobile, desktop, tablet) and connection type (4G, 3G, wifi). Identify which segment has the worst performance and list the top contributing URLs...
auditcore-web-vitalscrux
GEO v1.0

Entity Salience Prominence Brief

Maps how prominently your brand entity appears in LLM knowledge relative to topical competitors.

Prompt ChatGPT, Claude, and Perplexity with the following brand-adjacent queries: {query_list}. For each response, score {brand_name}'s entity salience (1-10) based on mention position, descriptive richness, and association with key topical concepts. Compare against competitor entity salience scores...
geoentitybrand-mentions
Content v1.0

FAQ Block Intent Gap Generator

Generates FAQ blocks that address intent gaps not covered by the main body of a target page.

Review the content of {page_url} targeting {primary_keyword}. Identify user questions from PAA boxes, forum threads, and related searches that the current page body does not answer. Generate a 10-question FAQ block in Q&A format, with each answer optimized for featured snippet eligibility (40-60 words, direct answer first)...
contentfaqintent-gap
GEO v1.0

Generative SERP Source Trust Model

Models the trust signals that make a domain a preferred source in generative SERP features.

Analyze the following set of domains consistently cited in generative SERP features for queries in the {industry} space: {cited_domain_list}. Reverse-engineer the shared trust signals (domain authority, content format, entity coverage, E-E-A-T indicators) and produce a trust signal checklist for {your_domain}...
geosource-trustgenerative-serp
Audit v1.0

Hreflang Return Tag Pair Audit

Validates that every hreflang tag has a correct reciprocal return tag on the target page.

Review the following hreflang implementation data across all locale variants for {site_url}: {hreflang_tag_list}. For every hreflang annotation, confirm the referenced URL contains a valid return tag pointing back. List all missing, mismatched, or self-referencing tag pairs...
audithreflanginternational
Audit v1.0

Image SEO Alt Tag Coverage Audit

Sweeps all images across key page types and scores alt text quality and filename SEO signals.

Analyze the following image inventory for {site_url}: {image_url_list}. For each image, evaluate: (1) whether alt text is present and descriptive, (2) whether the filename includes a relevant keyword, (3) whether the image is properly sized. Output a prioritized fix list...
auditimage-seoon-page
Audit v1.0

Log File Bot Segment Classifier

Segments server log entries by bot type to reveal Googlebot crawl patterns and wasted crawl budget.

Given the following server log data for {site_url}, segment all user-agent entries into categories (Googlebot, Bingbot, other crawlers, unknown bots, humans). For each bot segment, report crawl frequency, most-crawled URL paths, and HTTP status code distribution...
auditlog-filecrawl-budget
Technical v1.0

Robots.txt Crawl Priority Spec

Designs a robots.txt configuration that maximizes crawl budget allocation to high-value URL patterns.

Design a robots.txt file for {site_url} based on the following crawl priority requirements: {crawl_priority_rules}. Ensure the configuration: disallows all low-value URL patterns (facets, session IDs, internal search), allows all priority content paths, includes a sitemap directive, and includes separate user-agent rules for Googlebot, Bingbot, and GPTBot...
technicalrobots-txtcrawl-budget
Content v1.0

Schema Rich How-To Content Draft

Drafts a how-to article with embedded HowTo schema markup ready for publication and rich result eligibility.

Write a complete how-to article and matching HowTo JSON-LD schema for the topic: {how_to_topic}. The article must: answer the user query in the intro, include {num_steps} clearly numbered steps, embed tool and supply references where relevant, include an FAQ section, and be formatted so the JSON-LD schema mirrors the article step structure exactly...
contenthow-toschema
Audit v1.0

Technical Site Crawl Priority Audit

Identifies high-priority crawl issues across a site by analyzing URL structure and server responses.

Analyze the following crawl data for {site_url} and rank all detected issues by SEO severity (critical, high, medium, low), grouping them by type (4xx, 5xx, redirect loops, blocked resources). Provide a prioritized remediation checklist...
auditcrawltechnical
Content v1.0

Title Meta SERP CTR Batch Rewriter

Rewrites a batch of underperforming titles and meta descriptions to improve SERP click-through rates.

Rewrite the title tags and meta descriptions for the following pages: {page_list}. For each page, the rewrite must: stay within 60 characters (title) and 155 characters (meta), front-load the primary keyword, include a benefit or differentiator, and match the dominant SERP intent. Output in a table with old vs. new versions...
contentctrtitle-meta
Ranking v1.0

Video SERP Schema Gap Audit

Compares your VideoObject schema implementation against video SERP winners to find eligibility gaps.

Review the VideoObject structured data on {page_url} and compare it against the schema implementation of the top 5 video SERP results for {target_query}. Identify missing or low-quality properties (description, duration, thumbnailUrl, uploadDate, hasPart) and produce a schema patch spec...
rankingvideo-serpschema
Technical v1.0

XML Sitemap Split Priority Config

Designs a split sitemap index architecture that organizes URLs by type and crawl priority signal.

Design a sitemap index architecture for {site_url} with the following URL volume and type breakdown: {url_type_data}. Output a sitemap index file and individual sitemap specifications split by: content type (articles, products, categories, landing pages), with lastmod, changefreq, and priority attributes set based on crawl priority logic...
technicalsitemapcrawl
GEO v1.0

AI Overview Passage Optimizer

Rewrites content passages to improve retrieval likelihood in Google AI Overview responses.

Rewrite the following content passage from {page_url} to maximize its likelihood of being retrieved and cited in a Google AI Overview for the query '{target_query}'. Prioritize concise factual statements, direct question-answer structure, and entity clarity. Original passage: {passage_text}...
geoai-overviewpassage
GEO v1.0

Citation Pre-Publish Signal Checklist

Validates that a piece of content meets LLM citation-worthiness criteria before publishing.

Before publishing the content at {draft_url} or provided below, evaluate it against the following LLM citation-readiness criteria: factual density, entity clarity, direct answer presence, structured heading hierarchy, author credibility signals, schema markup, and external source citation quality. Output a pass/fail scorecard with fixes...
geocitationpre-publish
Ranking v1.0

Competitor Gap Cluster Map

Maps keyword clusters where competitors rank in top 3 but the target domain is absent or weak.

Using ranking data for {site_url} and competitors {competitor_list}, identify keyword clusters where at least two competitors rank in positions 1–3 but {site_url} ranks below position 20 or does not rank. Group gaps by topic cluster, estimate cluster traffic potential, and prioritize by ease of entry...
rankingcompetitorgap-analysis
Content v1.0

Content Brief SERP Gap Builder

Generates a content brief that fills specific gaps identified in current top-ranking SERP results.

Analyze the top 10 results for '{target_keyword}' and identify: topics covered by fewer than 3 results, questions left unanswered, data claims made without sources, and content formats absent from the SERP. Build a full content brief for {site_url} that addresses all identified gaps, including target word count, heading structure, and required entities...
contentcontent-briefserp-gap
Content v1.0

Content Refresh Traffic Recovery Plan

Prioritizes decayed content pages for refresh based on traffic loss, ranking drop, and effort score.

Using the provided Google Search Console and analytics export for {site_url}, identify all pages that have lost more than {traffic_drop_pct}% organic traffic in the past {time_period}. Score each by: traffic loss volume, ranking position change, SERP competitor freshness, and content update effort. Output a prioritized refresh queue with recommended actions per page...
contentcontent-decayrefresh
Audit v1.0

CrUX Core Web Vitals Deep Audit

Diagnoses CrUX field data discrepancies across device segments and page groups for a site.

Using the CrUX data export for {site_url}, compare LCP, INP, and CLS scores across mobile vs desktop segments and across page template groups (homepage, PDPs, blog). Identify which segments fail Core Web Vitals thresholds, surface the largest gaps between lab and field data, and recommend prioritized fixes...
auditcore-web-vitalscwv
Audit v1.0

Faceted Navigation Duplicate Audit

Identifies duplicate or near-duplicate pages created by faceted navigation parameters.

Review the faceted navigation structure of {site_url}. Given the following list of parameter-driven URLs, identify which parameter combinations create near-duplicate or thin content, assess canonical tag correctness, and recommend a robots.txt or canonical strategy to prevent crawl waste...
auditfaceted-navduplicate-content
Technical v1.0

Edge SEO Redirect Worker Script

Generates a Cloudflare Worker script to handle SEO-critical redirects at the edge without origin hits.

Write a Cloudflare Worker script for {site_url} that handles the following redirect rules at the edge: {redirect_rules_list}. The script should: match incoming request paths with regex, return 301 responses with correct Location headers, preserve query strings where specified, and include a logging hook for redirect hit tracking...
technicaledge-seocloudflare
GEO v1.0

Generative SERP Topical Gap Brief

Identifies topical subtopics underrepresented in generative SERP answers for a domain to target.

For the topic cluster '{primary_topic}', analyze current AI Overview and Perplexity responses for the top {n} related queries. Identify subtopics that are consistently discussed in generative answers but for which {brand_domain} has no indexable content. Produce a prioritized content gap list ranked by query volume...
geotopical-gapgenerative-serp
GEO v1.0

GEO Entity Depth Content Brief

Creates a GEO-focused content brief enriched with entities, claims, and citation-worthy facts.

Generate a GEO-optimized content brief for the topic '{target_topic}' targeting citation in AI-generated answers. Include: primary and secondary entities to address, factual claims to substantiate with data, recommended structure for LLM retrieval, and a list of authoritative sources the content should reference or outperform...
geocontent-briefentity
Audit v1.0

Image SEO Metadata Audit Runner

Audits image alt text, file names, structured data, and lazy-load configuration across a site.

Conduct an image SEO audit for {site_url} using the provided crawl export. For each image URL, evaluate: alt text presence and descriptiveness, filename keyword relevance, schema markup (ImageObject), lazy-load implementation correctness, and next-gen format usage. Prioritize fixes by traffic impact...
auditimage-seometadata
Ranking v1.0

Image SERP Schema Optimization Brief

Creates an optimization brief to improve image indexing and visibility in Google Image SERP.

Create an image SERP optimization brief for {site_url} targeting the topic '{image_topic}'. Include recommendations for: ImageObject schema implementation, alt text formulas, filename conventions, caption usage, surrounding text context, page load performance, and which image types (infographic, product, original photo) to prioritize...
rankingimage-serpschema
Content v1.0

Internal Link Anchor Gap Fixer

Identifies pages with weak or generic anchor text patterns and prescribes keyword-rich replacements.

Analyze the internal link anchor text profile for {target_url} on {site_url}. Identify all instances of generic anchors ('click here', 'read more', 'this page') and over-optimized exact-match anchors. For each, recommend a descriptive, intent-matched replacement anchor and the specific linking page and paragraph context to update...
contentanchor-textinternal-links
GEO v1.0

LLM Recency Signal Gap Audit

Identifies content gaps where stale or absent recency signals reduce LLM citation probability.

Audit {brand_domain}'s content library for recency signal gaps that may reduce citation likelihood in LLMs with web access. For each key topic in {topic_list}, identify: last publish/update date, freshness signals in metadata, competitor recency benchmarks, and recommended update cadences...
georecencyllm
Ranking v1.0

Local Pack Citation Builder

Audits local citation consistency and builds a fix plan to improve local pack rankings.

Audit the local citation profile for {business_name} in {location}. Check NAP (Name, Address, Phone) consistency across the top 20 citation sources (Google Business Profile, Yelp, Apple Maps, Bing Places, etc.). Identify inconsistencies, missing listings, and duplicate entries. Output a prioritized fix and submission plan...
rankinglocal-packcitations
Ranking v1.0

People Also Ask Intent Builder

Mines PAA questions for a seed keyword and maps them to content gaps and answer formats.

Expand the PAA (People Also Ask) question tree for the seed keyword '{seed_keyword}' to three levels deep. For each unique question, classify the intent type, identify whether {site_url} has content that answers it, and recommend the optimal answer format (paragraph, list, table) and target page for each gap...
rankingpaacontent-gap
GEO v1.0

Perplexity Source Competitor Gap Map

Maps which competitor domains Perplexity cites for target queries and identifies citation gaps.

For each query in {query_list}, document which domains Perplexity AI cites as sources in its answers. Build a competitor citation frequency table, identify queries where {brand_domain} is absent but competitors appear, and recommend content or authority improvements to close each gap...
geoperplexitycompetitor
Ranking v1.0

SERP Intent Mismatch Finder

Detects keywords where the landing page intent mismatches the dominant SERP intent type.

For each keyword in {keyword_list}, classify the dominant SERP intent (informational, navigational, commercial, transactional) based on the top 10 results. Then compare to the intent type of {site_url}'s current ranking page. Flag all mismatches and recommend whether to create a new page or rework the existing one...
rankingintentserp
Audit v1.0

Technical Site Crawl Planner

Generates a step-by-step crawl audit plan covering scope, tools, and prioritized issue triage.

You are a technical SEO specialist. Create a comprehensive crawl audit plan for {site_url}, covering crawl scope configuration, tool setup (Screaming Frog/Sitebulb), and a prioritized checklist of issues to surface including redirect chains, broken links, canonical conflicts, and orphan pages...
auditcrawltechnical
Content v1.0

Topic Cluster Spoke Identifier

Maps all spoke page opportunities for a pillar topic using keyword and SERP data.

For the pillar topic '{pillar_topic}', identify all viable spoke page topics by analyzing: long-tail keyword variants, PAA questions, SERP subtopic patterns, and competitor site architecture. Group spokes by intent type, assign target URLs on {site_url}, and flag gaps where no existing page qualifies...
contenttopic-clusterarchitecture
Ranking v1.0

Video SERP Clip Optimizer

Identifies video content opportunities and VideoObject schema requirements to rank in video SERP.

Analyze video SERP results for the query cluster '{query_cluster}'. Identify which video formats (tutorials, reviews, comparisons) dominate, average video duration, and hosting preferences (YouTube vs hosted). Then audit {site_url}'s existing video content against these patterns and recommend VideoObject schema and clip markup improvements...
rankingvideo-serpschema
Audit v1.0

Broken Link Priority Sweep

Triages broken internal and external links by PageRank and traffic impact.

Using the following broken link export for {domain} (columns: source_url, destination_url, status_code, source_page_traffic, source_page_inlinks), prioritize fixes by estimated link equity loss. Output a remediation table with suggested replacement URLs or removal recommendations...
auditbroken-linkslink-equity
Audit v1.0

Duplicate Content Facet Audit

Detects near-duplicate pages generated by faceted navigation and recommends canonicalization.

Analyze the following list of faceted navigation URLs from {domain}: {url_list}. Identify URL parameter combinations generating near-duplicate content, assess indexation status, and recommend a canonical strategy (canonical tag, noindex, or disallow in robots.txt) for each facet type...
auditfaceted-navduplicate-content
Content v1.0

E-E-A-T Author Bio Brief

Generates an optimized author bio template that maximizes E-E-A-T signals for Google.

Write an E-E-A-T-optimized author bio template for {author_name}, who has the following credentials: {credentials}. The bio should surface: direct experience, verifiable expertise markers, third-party recognition, and trust signals. Include schema markup recommendations for the author entity...
contente-e-a-tauthor
Content v1.0

FAQ Block Entity Generator

Generates semantically rich FAQ blocks that reinforce entity associations for a page.

For the page targeting '{primary_keyword}' on {domain}, generate 8–12 FAQ items that: address secondary intents from PAA research, reinforce the entity associations of {primary_entity}, include schema-ready question/answer pairs, and vary question formats (what, how, why, when) for maximum SERP feature coverage...
contentfaqentity
Ranking v1.0

Featured Snippet Format Audit

Audits current content against featured snippet format requirements for target queries.

For the following queries where {domain} ranks positions 2–10 but does not own the featured snippet: {query_list}, analyze the current snippet holder's format (paragraph, list, table), word count, and structural signals. Rewrite the recommended content block from {domain} to match and exceed the snippet format...
rankingfeatured-snippetcontent
Technical v1.0

Hreflang XML Locale Builder

Generates a complete hreflang XML sitemap configuration for a multi-locale site.

Generate a complete hreflang XML sitemap configuration for {domain} supporting the following locales: {locale_list}. For each URL set, produce the full set of xhtml:link alternate tags with correct hreflang values, x-default designation, and return tag pairs. Validate against Google's hreflang specification...
technicalhreflanginternational
Ranking v1.0

Image SERP Schema Gap

Identifies schema and metadata gaps preventing images from ranking in Google Image SERP.

Audit the top 20 images ranking in Google Image Search for '{target_query}'. Extract their alt text patterns, surrounding copy structure, schema markup types, and page authority signals. Compare against {domain}'s current image assets and output a structured optimization brief...
rankingimage-serpschema
Ranking v1.0

Knowledge Panel Entity Gap

Identifies missing entity attributes preventing a knowledge panel from appearing for a brand.

Analyze the current Google Knowledge Panel status for {brand}. Compare present entity attributes against those of {competitor_brands} with established panels. Identify missing attributes (e.g., founding date, key people, Wikipedia entry, Wikidata QID, structured mentions), and output a remediation roadmap...
rankingknowledge-panelentity
GEO v1.0

LLM Source Drift Diagnosis

Diagnoses why a previously cited source has lost LLM citation share over time.

Compare citation data for {domain} from {time_period_1} vs {time_period_2} across LLMs for queries in '{topic_space}'. Identify which queries lost citations, which competitors gained them, and hypothesize causal factors (content freshness decay, entity dilution, new competitor content). Output a recovery action plan...
geollmcitation
GEO v1.0

Multi-LLM Citation Consistency Test

Tests whether a brand is cited consistently across ChatGPT, Claude, Gemini, and Perplexity.

Submit the following test queries: {query_list} to ChatGPT, Claude, Gemini, and Perplexity. Record which model cites {brand}, the citation position, surrounding context, and any factual discrepancies. Output a cross-model citation consistency matrix and identify which LLM presents the highest visibility gap...
geomulti-llmcitation
Ranking v1.0

News SERP Freshness Gap Plan

Plans a content freshness strategy to improve News SERP and Top Stories inclusion rates.

Audit {domain}'s current Top Stories and News SERP inclusion rate for '{topic_area}' over the past {time_period}. Identify publishing frequency gaps, structured data deficiencies, and headline optimization opportunities versus competitors currently appearing in Top Stories. Output a freshness content calendar and technical spec...
rankingnews-serpfreshness
GEO v1.0

Perplexity Citation Source Audit

Identifies which competitor sources Perplexity cites for target queries and why.

For the following queries relevant to {brand}: {query_list}, document which sources Perplexity currently cites, analyze the structural and content signals that likely drove citation selection (e.g., freshness, entity density, authoritative backlinks), and identify content gaps {domain} must close to compete...
geoperplexitycitation
Audit v1.0

Redirect Chain Consolidation Plan

Maps multi-hop redirect chains and outputs a direct-redirect consolidation spec.

Analyze the following redirect chain data for {domain}: {redirect_chain_csv}. Identify all chains exceeding two hops, calculate PageRank dilution risk, and produce a consolidation plan mapping each origin URL directly to its final destination with the correct HTTP status code...
auditredirectscrawl
Content v1.0

Schema-Rich HowTo Drafter

Drafts a HowTo article with embedded JSON-LD schema and step-by-step SERP-ready structure.

Write a schema-ready HowTo article for '{how_to_topic}' targeting {audience}. Structure each step with a clear name, image alt text recommendation, and supply/tool declaration. Append valid JSON-LD HowTo schema markup covering all steps, estimated time, and total cost where applicable...
contenthow-toschema
Technical v1.0

Security Headers SEO Audit

Audits HTTP security headers for misconfigurations that may negatively impact SEO crawling.

Audit the following HTTP response headers for {domain}: {headers_dump}. Identify any security header settings that may negatively impact Googlebot (e.g., overly restrictive CSP blocking critical resources, HSTS misconfiguration, X-Frame-Options affecting embedded content indexing). Output a corrected header configuration with SEO risk ratings...
technicalsecurity-headersaudit
Content v1.0

Title Tag SERP CTR Rewrite

Rewrites underperforming title tags using CTR psychology and SERP differentiation tactics.

Given the following title tags with low CTR from Google Search Console for {domain}: {title_ctr_csv} (columns: current_title, target_keyword, impressions, ctr, position), rewrite each title to improve click-through rate using power words, number inclusion where relevant, and emotional triggers while staying under 60 characters...
contenttitle-tagctr
Technical v1.0

XML Sitemap Index Spec

Engineers an XML sitemap index architecture for large sites with segmented sub-sitemaps.

Design an XML sitemap index architecture for {domain} with {total_url_count} indexable URLs across the following page types: {page_type_list}. Specify sub-sitemap segmentation logic, lastmod update frequency per segment, priority and changefreq values, submission strategy to Google Search Console, and error monitoring plan...
technicalsitemapcrawl
GEO v1.0

AI Mode Intent Fit Scorer

Scores how well a page's content matches the intent patterns triggered in Google AI Mode results.

Evaluate the content at {url} against the AI Mode query intent patterns for '{target_topic}'. Score the page on query intent alignment, answer completeness, entity coverage, and cited source format. Output a score with specific edits to improve AI Mode visibility...
geoai-modeintent
GEO v1.0

AI Overview Passage Scorer

Scores existing content passages for likelihood of inclusion in Google AI Overview responses.

Evaluate the following content passages from {url} against the query '{target_query}'. Score each passage 1–10 for AI Overview inclusion likelihood based on directness, factual density, source authority signals, and formatting, then recommend edits to improve the lowest-scoring passages...
geoai-overviewpassages
Audit v1.0

Canonical Conflict Chain Audit

Detects canonical tag conflicts, chains, and self-referential errors across a site's URL inventory.

Analyze the canonical tag data from this crawl of {domain}: {canonical_data}. Identify all canonical chains (A→B→C), conflicting canonicals (canonical pointing to a noindex page), and missing self-referencing canonicals, then output a corrected canonical map...
auditcanonicalduplicate-content
Content v1.0

Content Brief Entity Signals

Generates a content brief enriched with entity associations and authority signals for a target query.

Create a content brief for a page targeting '{target_query}' on {domain}. Include: search intent analysis, required entities and their relationships, E-E-A-T authority signals to incorporate, recommended word count, content structure, and internal linking targets...
contententitybrief
Content v1.0

Content Outline PAA Integration

Builds a content outline that integrates PAA questions as section headers for featured snippet targeting.

Using the following PAA questions for '{seed_query}': {paa_list}, create a content outline for a page on {domain} where each PAA question becomes a structured H2 or H3 section. Include recommended answer formats (paragraph, list, or table) and target word counts per section...
contentoutlinepaa
GEO v1.0

Entity Salience Gap Mapper

Maps gaps between a brand's intended entity associations and its current LLM-perceived associations.

Given {brand}'s target entity associations: {target_entities}, and the following LLM response samples mentioning {brand}: {llm_responses}, identify which target entities are absent or weakly associated in LLM outputs and prescribe content actions to strengthen each association...
geoentitybrand
Technical v1.0

Hreflang XML Locale Config

Generates complete hreflang XML sitemap entries for a defined set of locale-URL pairs.

Generate hreflang XML sitemap entries for the following locale-URL mapping: {locale_url_map}. Ensure all return tags are bidirectional, x-default is correctly assigned, and the output is formatted as valid XML sitemap markup ready for deployment...
technicalhreflanginternational
Ranking v1.0

Image SERP Markup Gap Finder

Finds structured data and metadata gaps preventing images from ranking in Google Image SERP features.

Audit the image assets at {url} for Image SERP ranking eligibility. Check for missing or suboptimal alt text, file naming, image schema (ImageObject), page context relevance, and Core Web Vitals image metrics. Output a prioritized fix list with example corrected markup...
rankingimage-serpstructured-data
Ranking v1.0

Keyword Cannibalization Intent Map

Maps cannibalizing keyword groups by intent overlap and prescribes consolidation or differentiation.

Given this list of cannibalizing keyword-URL pairs for {domain}: {cannibalization_data}, classify each conflict as same-intent (requiring consolidation) or different-intent (requiring differentiation). Output a resolution plan specifying which page to canonicalize, merge, or reposition for each group...
rankingcannibalizationintent
Ranking v1.0

Local Pack Competitor Gap

Compares local pack ranking signals between a target business and its top local pack competitors.

Analyze local pack rankings for '{target_keyword}' in {location}. Compare the following signal categories for {business} vs top 3 pack competitors: {competitor_list} — GBP completeness, review velocity, category alignment, citation consistency, and local content signals. Output a gap-priority action plan...
rankinglocal-packlocal-seo
Audit v1.0

Mobile-First Indexing Audit

Checks whether mobile and desktop versions of key pages are equivalent for Google's mobile-first index.

Compare the mobile and desktop rendered HTML for the following URLs on {domain}: {url_list}. Flag any content, structured data, meta tags, or internal links present on desktop but missing on mobile, and prioritize fixes by SEO impact...
auditmobile-firstindexing
GEO v1.0

Multi-LLM Citation Gap Audit

Compares citation presence and gaps for a brand across ChatGPT, Perplexity, and Claude simultaneously.

Test the query set {query_list} across ChatGPT, Perplexity, and Claude. For each query, record whether {brand} is cited, in what context, and with what sentiment. Output a gap matrix identifying which LLMs underperform and what content changes could improve citation rate...
geomulti-llmcitations
Ranking v1.0

PAA Cluster Expansion Builder

Mines People Also Ask data to build an expanded semantic cluster for a target topic.

Using the following PAA data for the seed query '{seed_query}': {paa_data}, map all questions into semantic clusters, identify which clusters {domain} has no content for, and output a prioritized content expansion plan with recommended page types...
rankingpaakeyword-research
Technical v1.0

Security Headers CSP SEO Audit

Audits Content Security Policy and security headers for configurations that impact SEO rendering.

Review the security headers for {domain}: {header_data}. Identify CSP directives that block Googlebot from rendering JavaScript, inline styles, or external resources required for correct page rendering. Output a revised CSP policy that maintains security requirements while enabling full SEO rendering...
technicalsecurity-headerscsp
Content v1.0

Programmatic SEO Seed Builder

Generates a programmatic content seed template for scalable page production at scale.

Design a programmatic SEO content template for {domain} targeting the pattern '{url_pattern}'. Define the dynamic variables, static content sections, required schema type, internal linking logic, and quality differentiation rules that prevent thin-content penalties across {estimated_page_count} pages...
contentprogrammatic-seotemplate
Ranking v1.0

SERP Intent Alignment Classifier

Classifies a keyword list by dominant SERP intent and flags pages misaligned with that intent.

For each keyword in the following list: {keyword_list}, classify the dominant SERP intent (informational, navigational, commercial, transactional) using the top-5 ranking URLs as evidence. Flag any {domain} pages currently targeting these keywords that are misaligned with the dominant intent...
rankingintentserp
Ranking v1.0

News SERP Freshness Plan

Builds a freshness signal improvement plan for News SERP and Google Discover visibility.

Review the publishing cadence, article schema implementation, and freshness signals for {domain}'s news content. Compare against top News SERP performers for {topic}. Identify gaps in publish frequency, NewsArticle schema, AMP usage, and sitemaps, then output a 30-day freshness improvement plan...
rankingnews-serpfreshness
Ranking v1.0

SERP Volatility Cause Report

Diagnoses root causes of ranking volatility for a page or keyword set over a defined time window.

Given the following ranking position history for {domain} across keyword set {keyword_list} over the period {date_range}: {rank_data}, identify volatility patterns, correlate with known algorithm updates or site changes, classify the volatility cause type, and recommend stabilization actions...
rankingvolatilityserp
Technical v1.0

XML Sitemap Split Architect

Designs an XML sitemap index split strategy for large sites with complex content taxonomies.

Design an XML sitemap index architecture for {domain} which has {total_url_count} indexable URLs across the following content types: {content_types}. Define how to split sitemaps by content type, set priority and changefreq values, and write the sitemap index XML structure...
technicalsitemapcrawl
GEO v1.0

AI Overview Query Readiness Scorer

Scores a set of target queries for likelihood of triggering an AI Overview and suggests optimisations.

Act as a Generative Engine Optimisation specialist. For each query in the following list {query_list}, score its likelihood of triggering a Google AI Overview (1–10) based on intent type, query length, informational complexity, and current SERP layout signals. For queries scoring 7+, provide a specific content optimisation recommendation to increase inclusion probability...
geoai-overviewserp
Content v1.0

Content Brief Competitor SERP Match

Builds a content brief by analysing the top 10 SERP results for a target query and extracting winning patterns.

Act as a content strategist. For the target query {target_query}, analyse the following top 10 SERP results including their titles, headings, word counts, schema types, and featured SERP features: {serp_data}. Extract the dominant content patterns, required subtopics, common heading structures, and E-E-A-T signals. Produce a complete content brief for {domain} that is specifically designed to rank in positions 1–3 for this query...
contentcontent-briefserp
Content v1.0

Content Decay Revenue Impact Triage

Triages a list of declining content pages by revenue impact to prioritise refresh investment.

Act as a content performance analyst. Given the following data for {domain}'s content pages — URL, page type, 24-month organic traffic trend, assisted conversion value, and average position trend: {page_performance_data} — identify all pages exhibiting content decay (declining traffic + declining rankings over 6+ months). Rank them by revenue impact and produce a triage matrix with a recommended action for each: refresh, consolidate, redirect, or retire...
contentcontent-decayrevenue
Content v1.0

Content Gap Cluster Priority Finder

Identifies topic clusters where a site lacks coverage and ranks them by traffic opportunity.

Act as a content gap analyst. Using the following site crawl data for {domain} — including all indexed URLs and their topic tags — and the following competitor topic coverage map for {competitor_list}: {gap_data} — identify topic clusters where {domain} has zero or minimal coverage but competitors have established content. Rank each gap cluster by estimated monthly traffic opportunity and produce a content creation priority roadmap...
contentcontent-gapcluster
Content v1.0

Content Outline Topical Depth Builder

Creates a topically comprehensive content outline that covers all subtopics required for ranking authority.

You are a topical authority content strategist. For the primary topic {topic} targeting {audience} on {domain}, build a full content outline that covers all required subtopics for topical depth based on entity co-occurrence analysis, PAA questions, and SERP content gaps. Structure the outline with H1–H3 headings, specify the content type and format for each section, and note which sections require expert author attribution for E-E-A-T...
contentoutlinetopical-authority
Audit v1.0

Crawl Budget Priority Segmentation

Segments all site URLs into crawl-worthy and crawl-wasteful buckets to guide budget optimisation.

You are a crawl budget strategist. Using the following URL inventory for {domain} — including URL, page type, organic sessions (last 90 days), index status, and canonical target — segment every URL into one of four buckets: High Priority Crawl, Low Priority Crawl, Block via robots.txt, or Consolidate via canonical. Provide a bucketing rationale and a robots.txt/canonical directive plan...
auditcrawl-budgettechnical
GEO v1.0

Entity Salience Gap Profiler

Identifies entities strongly associated with a topic in LLM outputs that are absent from a target page.

You are an entity SEO specialist. For the topic {topic}, the following entities appear with high salience in LLM-generated answers: {entity_list}. Review the content of {url} and identify which of these entities are absent, mentioned superficially, or missing co-occurrence context. Output a prioritised entity enrichment plan with recommended placement and supporting facts for each missing entity...
geoentitysalience
Content v1.0

FAQ Intent Entity Schema Builder

Generates FAQ content blocks with embedded entity context and FAQPage schema for a target topic.

Act as a content and structured data specialist. For the topic {topic} on {url}, generate 8 FAQ question-and-answer pairs that address the highest-volume PAA questions, embed relevant named entities in each answer, and keep each answer between 40–60 words for featured snippet eligibility. Output the FAQ content in plain text and as a complete valid FAQPage JSON-LD schema block ready for implementation...
contentfaqschema
Audit v1.0

Indexing Gap Coverage Diagnostics

Diagnoses why strategic URLs are excluded from the Google index using GSC coverage data.

Act as an indexation specialist. Given the following Google Search Console URL Inspection export for {domain} showing URLs with 'Excluded' status and their exclusion reasons, group URLs by exclusion reason, identify the root cause for each group, and produce a remediation plan with the specific technical fix, owner, and estimated re-indexation timeline for each group...
auditindexinggsc
Content v1.0

Internal Link Anchor Strategy Map

Produces an anchor text strategy for internal links targeting a specific pillar page's ranking goals.

Act as an internal linking and anchor text strategist. For the pillar page {target_url} targeting the primary keyword {primary_keyword} on {domain}, analyse the existing internal link anchor text distribution from the crawl data: {crawl_data}. Identify over-optimised, generic, or missing anchor text patterns. Produce an anchor text diversification strategy specifying exact anchor text variants, source pages, and placement recommendations...
contentinternal-linksanchor-text
Audit v1.0

JS Render Content Gap Finder

Compares raw HTML vs. rendered DOM to expose content and links invisible to Googlebot.

You are a JavaScript SEO specialist. Given the following raw HTML response and fully-rendered DOM for {url} — Raw HTML: {raw_html} — Rendered DOM: {rendered_dom} — identify all content nodes, internal links, structured data blocks, and meta tags present in the rendered DOM but absent in the raw HTML. Classify each gap by crawl/index risk and recommend a server-side rendering or prerender fix...
auditjs-renderingtechnical
Technical v1.0

LCP Resource Waterfall Optimizer

Analyses the LCP resource load chain and outputs specific optimisations to reduce LCP time.

Act as a Core Web Vitals LCP specialist. Given the following WebPageTest waterfall and LCP element details for {url}: {waterfall_data} — identify the LCP element, its resource type, and all blocking requests in its critical path. Calculate the time lost at each stage (TTFB, resource load delay, render delay). Produce a prioritised fix plan specifying preload hints, image format changes, server-side optimisations, and third-party deferral strategies...
technicallcpperformance
GEO v1.0

LLM Recency Content Refresh Plan

Identifies content pages losing LLM citations due to staleness and builds a recency refresh plan.

You are a GEO content strategist focused on LLM recency signals. For the following list of pages on {domain} — including URL, last-modified date, topic, and current LLM citation status: {page_data} — identify pages at risk of citation loss due to content age. For each at-risk page, produce a specific refresh plan specifying new facts to add, outdated claims to update, and publication date signals to strengthen...
georecencycontent-refresh
GEO v1.0

Multi-LLM Brand Visibility Matrix

Compares brand mention frequency and context across ChatGPT, Claude, Gemini, and Perplexity.

You are a multi-LLM brand visibility analyst. Using the following structured query test results across ChatGPT, Claude, Gemini, and Perplexity for {brand} in topic area {topic}: {llm_test_results} — build a visibility matrix showing mention rate, sentiment, positioning context, and citation URL (where available) per model. Highlight models where {brand} is absent and recommend targeted content actions...
geomulti-llmbrand
Ranking v1.0

News SERP Freshness Eligibility Brief

Diagnoses why a publisher is excluded from News SERP and Top Stories and builds a fix plan.

You are a Google News SEO specialist. For the publisher {domain}, review the following technical and content signals relevant to Top Stories/News SERP inclusion: {site_signal_data}. Diagnose why the site is failing to appear for target queries {target_queries}, assessing article schema, publication timestamps, byline markup, NewsArticle eligibility, crawl frequency, and page speed. Produce a ranked remediation plan with expected impact...
rankingnews-serppublisher
Audit v1.0

Orphan Page Link Priority Map

Identifies orphan pages from a crawl export and ranks them by traffic potential for link reinstatement.

You are an internal linking strategist. Given this crawl export CSV for {domain} — containing URL, inbound internal links, estimated organic traffic, and indexation status — identify all pages with zero inbound internal links. Rank them by organic traffic potential, suggest the three most contextually relevant existing pages from which to add links, and propose anchor text for each...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Intent Question Expander

Expands a seed keyword into a structured PAA question tree with intent classifications.

Act as a People Also Ask research specialist. Starting from the seed keyword {seed_keyword}, build a PAA question tree by simulating recursive PAA expansion to depth 3. For each question, classify its intent (informational, comparison, how-to, definition, or troubleshooting), assign a content format recommendation, and identify which existing page on {domain} — or a new page to create — should target each question...
rankingpaakeywords
Content v1.0

Programmatic SEO Page Template Brief

Designs a scalable programmatic content template with dynamic variables and quality safeguards.

You are a programmatic SEO architect. For the page type {page_type} on {domain}, design a scalable content template that targets long-tail keyword pattern {keyword_pattern}. Specify all dynamic content variables, static boilerplate sections, minimum unique content requirements per page, required schema type, internal linking logic, and quality threshold checks to prevent thin content penalties. Include a sample page output using example data...
contentprogrammatic-seotemplate
Audit v1.0

Redirect Chain URL Graph Audit

Maps multi-hop redirect chains from a URL list and calculates equity dilution at each hop.

Act as a redirect audit specialist. Given the following list of redirect chains for {domain}: {redirect_chain_list}, map each chain as a directed graph showing source URL, intermediate hops, final destination, HTTP status at each step, and estimated PageRank dilution per hop. Flag chains exceeding 2 hops or containing 302s that should be 301s, and output a consolidation plan...
auditredirectscrawl
Technical v1.0

Security Headers SEO CSP Config

Generates security headers including a CSP policy that protects the site without breaking SEO signals.

You are a security and technical SEO specialist. For {domain}, generate a complete HTTP security headers configuration including Content-Security-Policy, Strict-Transport-Security, X-Frame-Options, X-Content-Type-Options, Referrer-Policy, and Permissions-Policy. The CSP must permit {required_third_parties} while blocking untrusted sources, and must not block Googlebot rendering of any critical content or structured data. Provide the header values and an nginx/Apache config snippet...
technicalsecurity-headerscsp
Technical v1.0

Server-Side Rendering SEO Decision Matrix

Evaluates SSR vs CSR vs hybrid rendering options for each page type and recommends the optimal strategy.

Act as a rendering SEO architect. For {domain} using {framework}, evaluate the rendering strategy (SSR, CSR, SSG, ISR, or hybrid) currently used for each page type: {page_type_list}. For each type, assess Googlebot crawl and render risk, Time to First Byte impact, JavaScript dependency depth, and content freshness requirements. Produce a rendering strategy decision matrix with a specific recommendation and migration effort estimate for each page type...
technicalrenderingssr
GEO v1.0

Source Authority LLM Signal Audit

Audits the off-page authority signals that determine whether a domain is trusted as an LLM source.

Act as a GEO source authority analyst. For {domain}, audit the following authority signal categories that influence LLM source selection: editorial backlink profile, Wikipedia citations, academic citations, news media mentions, author credential visibility, and YMYL topic alignment. Score each category, benchmark against top-cited competitors {competitor_list}, and produce a signal-strengthening action plan...
geoauthorityllm
Content v1.0

Title Meta SERP Rewrite Batch

Rewrites title tags and meta descriptions for a batch of pages to maximise CTR based on SERP context.

You are a SERP CTR optimisation specialist. For each page in the following list — URL, current title tag, current meta description, target keyword, current position, and current CTR: {page_data} — rewrite the title tag and meta description to maximise CTR. Follow these constraints: title 50–60 characters, meta description 140–155 characters, include primary keyword, use a power word, and differentiate from the current SERP titles of competitors at positions 1–5...
contenttitle-tagsctr
Ranking v1.0

Video SERP Schema Brief

Produces a schema and metadata optimisation brief to earn video rich results in Google Video SERP.

Act as a video SEO specialist. For the video at {video_url} hosted on {domain}, audit the existing VideoObject schema, thumbnail quality, title tag, description, transcript availability, and page embedding context. Compare against the top 5 Video SERP results for the target query {target_query}. Produce a complete optimisation brief specifying corrected JSON-LD, thumbnail recommendations, and transcript/chapter mark improvements...
rankingvideo-serpschema
GEO v1.0

AI Mode Feature Gap Planner

Plans content and structural changes needed for {site_url} to appear in Google AI Mode responses.

Analyze AI Mode SERP results for the following 10 queries relevant to {site_url}. Document the content types, source formats, and topical depth of pages currently featured. Identify the gaps between those featured pages and {site_url}'s existing content and produce a gap-close roadmap...
geoai-modevisibility
GEO v1.0

AI Overview Passage Gap Scorer

Scores existing content passages against AI Overview inclusion criteria and surfaces gaps to close.

Review the following content page from {site_url} targeting the query '{target_query}'. Score each paragraph against AI Overview inclusion signals (directness, factual density, citation-worthiness). Highlight low-scoring passages and rewrite them to improve retrieval likelihood...
geoai-overviewpassage
Ranking v1.0

Branded Query SERP Gap Plan

Analyzes branded SERP real estate and plans actions to increase owned result share for brand queries.

Search for the top 20 branded queries for '{brand_name}' and document the current SERP composition (owned, third-party, review sites, news). Identify slots currently owned by non-brand-controlled sources and recommend content, schema, and offsite actions to reclaim SERP real estate...
rankingbrandedserp-ownership
GEO v1.0

Claude Source Selection Audit

Analyzes patterns in Claude's source preferences for a given topic to inform content positioning strategy.

Submit the following 15 informational queries about {topic} to Claude and record which sources or domains it references in responses. Identify recurring source characteristics (format, depth, authority signals) and map them against {site_url}'s current content...
geoclaudecitation
Ranking v1.0

Competitor Featured Snippet Gap

Identifies featured snippets owned by competitors that {site_url} is positioned to capture with content edits.

For the following list of competitor domains competing with {site_url}, identify all keywords where they hold a featured snippet that {site_url} ranks in positions 1–10 but does not own. Score each opportunity by search volume and snippet format, and suggest specific content edits to displace...
rankingfeatured-snippetcompetitor
Content v1.0

Content Decay Intent Shift Audit

Diagnoses whether content traffic decay is caused by SERP intent shifts rather than content quality issues.

For each of the following decaying pages on {site_url}, compare the current SERP intent composition for the target keyword against the intent composition from {comparison_date}. Determine whether traffic loss is caused by intent shift, rank drop, or CTR change, and prescribe content-type or format adjustments accordingly...
contentcontent-decayintent
Content v1.0

E-E-A-T Author Signal Plan

Produces a concrete plan to strengthen author E-E-A-T signals across key content pages for a site.

Audit the author byline, bio, credential markup, and offsite authority signals for the top {page_count} content pages on {site_url}. Score each author profile against Google's E-E-A-T criteria and output a per-author action plan covering on-page bio updates, schema additions, and external credibility building...
contente-e-a-tauthor
GEO v1.0

Entity Salience Content Audit

Measures how prominently target entities appear in your content versus LLM-preferred competitor sources.

For the target entity '{entity_name}', analyze the content at {site_url} versus the top 5 competitor pages cited in AI Overviews. Score entity salience (mention frequency, semantic context, co-occurrence) for each page and prescribe specific content edits...
geoentitysalience
GEO v1.0

Generative SERP Source Readiness

Evaluates a page's structural and content readiness to appear as a source in generative SERP features.

Evaluate the following URL from {site_url} for generative SERP source readiness. Assess: clear topical focus, factual claim density, author authority signals, structured formatting, and schema presence. Output a readiness score out of 100 with specific improvement actions...
geogenerative-serpreadiness
Technical v1.0

Hreflang Return Tag Matrix

Validates that all hreflang tags have correct bidirectional return tags across the full locale set.

Given the hreflang tag data extracted from {site_url} covering {locale_count} locales, build a return-tag matrix. Identify any locale pair where the reciprocal hreflang annotation is missing or incorrect, flag x-default misconfigurations, and output a corrected XML sitemap hreflang block for each affected URL...
technicalhreflanginternational
GEO v1.0

LLM Recency Content Gap Finder

Detects content freshness gaps that cause LLMs to prefer recently updated competitor sources over yours.

Compare the publication and last-updated dates of the top LLM-cited sources for '{topic}' against the equivalent pages on {site_url}. Identify pages where {site_url} content is older by more than {days_threshold} days and generate a refresh priority list...
geofreshnessllm
Audit v1.0

Log File Render Gap Audit

Cross-references server log Googlebot visits against rendered page states to expose JS-hidden content gaps.

Using the server log sample for {site_url}, cross-reference Googlebot fetch timestamps with the list of URLs where client-side rendering is required. Identify pages Googlebot visited but likely received incomplete content, and estimate the indexing risk for each...
auditlog-filejs-rendering
Audit v1.0

Mobile First Parity Checker

Compares desktop and mobile-rendered content parity to surface gaps that could hurt mobile-first indexing.

Compare the desktop and mobile-rendered HTML snapshots for the following URLs on {site_url}. Flag any headings, body text, structured data, or internal links present on desktop but absent from the mobile render, and estimate indexing risk...
auditmobile-firstrendering
GEO v1.0

Multi LLM Citation Variance Audit

Compares citation patterns across ChatGPT, Claude, and Perplexity to find platform-specific visibility gaps.

For each of the following 10 queries in '{topic}', record the cited or referenced sources from ChatGPT, Claude, and Perplexity. Build a variance matrix showing which sources appear across all three, only one, and none. Identify {site_url}'s position and prescribe platform-specific actions...
geomulti-llmcitation
Ranking v1.0

News SERP Freshness Audit

Evaluates content freshness signals and publication markup needed to qualify for News SERP features.

Audit the top 10 news-eligible content pages on {site_url}. For each page, assess publication date markup, update frequency, NewsArticle schema, byline signals, and AMP status. Compare against pages currently appearing in the News SERP box for '{target_topic}' and produce a gap fix list...
rankingnews-serpfreshness
Audit v1.0

Orphan Page Link Plan

Detects orphaned URLs and generates a concrete internal linking plan to restore crawl and equity flow.

Given the crawl export and internal link map for {site_url}, identify all URLs that receive zero internal links. For each orphan, suggest the three most relevant linking source pages already in the index and propose anchor text...
auditorphan-pagesinternal-links
Technical v1.0

Prerender SEO Config Builder

Builds a prerendering configuration spec for JavaScript-heavy sites to ensure full content delivery to crawlers.

Design the prerendering configuration for {site_url} built on {framework}. Specify which URL patterns should be prerendered, the prerender trigger conditions for bot detection, the caching TTL for prerendered snapshots, and how to handle dynamic content like prices or availability. Include a middleware or Cloudflare Worker implementation outline...
technicalprerenderingjs-seo
Ranking v1.0

People Also Ask Intent Gap Mapper

Mines PAA boxes for a keyword set to uncover intent gaps not covered by current site content.

For the following seed keyword list related to {topic}, extract all People Also Ask questions from the top 3 SERP positions. Cluster questions by intent sub-type, map them against existing content on {site_url}, and flag unanswered clusters as content opportunities...
rankingpaacontent-gaps
Content v1.0

Programmatic Content Schema Plan

Designs a schema-enriched programmatic content template for scalable page generation with rich result eligibility.

Design a programmatic content template for the '{page_type}' pages on {site_url}. Define the dynamic content slots, required static content sections for quality thresholds, JSON-LD schema types to include, and internal linking logic. The output should be implementable as a CMS template or code component...
contentprogrammaticschema
Audit v1.0

Redirect Chain Health Checker

Evaluates redirect chains for length, loop risk, and PageRank dilution across a full URL list.

Process the following redirect log for {site_url} and flag any chain exceeding {max_hops} hops, any redirect loops, and any non-301 status codes in the chain. Output a severity-ranked fix list with consolidated target URLs...
auditredirectscrawl
Technical v1.0

Robots.txt Crawl Rule Builder

Generates a precision robots.txt file with crawl rules optimized for Googlebot crawl budget allocation.

Generate an optimized robots.txt file for {site_url}. Based on the following list of URL patterns to disallow, crawl-rate constraints, and sitemap locations, write the complete robots.txt content. Include separate directives for Googlebot, Googlebotimage, and common SEO crawlers. Annotate each rule with its crawl-budget rationale...
technicalrobots-txtcrawl-budget
Audit v1.0

Schema Type Coverage Sweep

Audits all page templates for missing schema types relative to SERP-eligible rich result opportunities.

Review the following list of page templates and their current schema markup for {site_url}. For each template, identify which Google-eligible schema types are absent, score the rich-result opportunity, and output a prioritized implementation checklist...
auditschemarich-results
Technical v1.0

SSR Hydration Gap Detector

Detects content and markup gaps between server-rendered HTML and post-hydration DOM for SEO impact assessment.

Compare the raw server-rendered HTML response and the post-hydration DOM snapshot for the following {page_count} pages on {site_url}. Identify any headings, body content, internal links, structured data, or canonical tags present in one but absent from the other. Score the indexing risk for each discrepancy...
technicalssrrendering
Content v1.0

Topic Cluster Gap Identifier

Identifies missing spoke pages in an existing topic cluster that are needed to close topical authority gaps.

Review the current topic cluster structure for '{pillar_topic}' on {site_url}. Using the top-ranking competitor sites as a benchmark, identify sub-topics and supporting pages they cover that are absent from {site_url}'s cluster. Output a prioritized list of missing spoke pages with recommended URLs and target keywords...
contenttopic-clustergaps
Ranking v1.0

Branded Query Intent Classifier

Classifies branded query intents and maps current SERP ownership gaps by intent type.

Analyze the following branded query list for {brand_name}: {branded_query_list}. Classify each query by intent type (navigational, informational, transactional, or reputational), identify which SERP features are present for each, and flag any intent types where {brand_name} does not own the top position or featured snippet...
rankingbrandedintent
GEO v1.0

ChatGPT Brand Entity Readiness

Scores a brand's entity signals for likelihood of ChatGPT citation in answer responses.

Evaluate the following brand entity profile for {brand_name}: {entity_profile_json}. Score it across Wikipedia presence, Knowledge Graph entry, third-party citation diversity, recency of mentions, and structured data coverage. Output a readiness score out of 100 with improvement actions...
geochatgptentity
Ranking v1.0

Competitor Snippet Gap Analysis

Finds queries where a competitor holds a featured snippet or PAA that your domain could win.

Using the following competitor SERP feature ownership data for {competitor_domain} vs {your_domain}: {serp_feature_csv}, identify all featured snippets and PAA boxes owned by the competitor where your domain ranks in positions 2–10. For each, output the current snippet content, the gap, and a content rewrite brief to win the feature...
rankingcompetitorfeatured-snippet
Content v1.0

Content Decay Page Prioritizer

Ranks decaying pages by traffic loss severity and refresh ROI to prioritize the update queue.

Given the following content performance data showing traffic trends over {time_period}: {content_performance_csv}, identify pages with consistent organic traffic decline of more than {decline_threshold}%. Score each by refresh ROI (based on current ranking position, backlinks, and topic search volume) and output a prioritized refresh queue...
contentcontent-decayrefresh
Content v1.0

E-E-A-T Author Expertise Brief

Builds an author expertise profile brief to strengthen E-E-A-T signals on YMYL content.

For the author {author_name} who writes about {topic_area} on {domain}, audit current E-E-A-T signals: author bio completeness, credential citations, external publication history, social proof links, and schema Person markup. Output a brief to enhance expertise signals on all authored pages...
contente-e-a-tauthority
GEO v1.0

GEO Entity Prominence Optimizer

Builds an entity prominence brief to increase brand salience in LLM-generated answers.

Using the entity relationship data for {brand_name}: {entity_graph_json}, identify which co-occurring entities and topical associations are currently weak or absent. Produce a content and PR brief to increase entity prominence in LLM training corpora and real-time retrieval indexes...
geoentitybrand
GEO v1.0

LLM Recency Freshness Optimizer

Diagnoses freshness signals on pages to improve likelihood of citation in recency-sensitive LLM answers.

Audit the following pages for recency signals relevant to LLM citation: {page_url_list}. Evaluate publication date markup, last-modified headers, changelog sections, byline dates, and corpus crawl frequency. Output a freshness improvement plan ranked by GEO citation impact...
geofreshnessllm
Audit v1.0

Log File Crawl Frequency Gap

Surfaces pages Googlebot crawls too rarely or too often relative to their strategic value.

Given the following server log summary showing Googlebot crawl frequency per URL segment {log_summary_csv}, identify pages crawled less than once per {threshold_days} days that have high business value, and pages over-crawled relative to their update frequency...
auditlog-filecrawl-budget
Audit v1.0

Orphan Page Equity Recovery

Identifies orphaned pages and prescribes internal linking fixes to restore crawl equity.

Analyze the following list of URLs with zero internal inlinks: {orphan_url_list}. For each, recommend the top 3 existing pages to link from, the anchor text to use, and the editorial rationale...
auditinternal-linkscrawl
GEO v1.0

Perplexity Source Competitor Gap

Identifies competitors consistently cited by Perplexity that your domain is missing from.

For the following queries where {competitor_domain} is cited in Perplexity answers but {your_domain} is not: {query_list}, analyze the cited passages, determine what content attributes (depth, recency, schema, source authority) differentiate the cited pages, and output a gap remediation brief...
geoperplexitycitation
Technical v1.0

Prerender Eligibility Decision Tree

Builds a decision tree to determine which page types should use prerendering vs. SSR vs. CSR.

Create a rendering decision tree for {domain} covering the following page types: {page_type_list}. For each, evaluate JavaScript dependency level, personalization requirements, update frequency, and Googlebot crawl data. Output a recommendation matrix specifying prerender, SSR, CSR, or hybrid rendering, with implementation notes for each page type...
technicalprerenderingrendering
Audit v1.0

Redirect Chain Opportunity Mapper

Detects multi-hop redirect chains and outputs a consolidation plan to reduce link equity loss.

Using the following redirect chain data {redirect_chain_csv}, identify all chains with 2 or more hops, quantify estimated PageRank dilution per chain, and produce a consolidated 301 map that collapses each chain to a single hop...
auditredirectscrawl
Content v1.0

Schema Rich How-To Builder

Drafts step-by-step how-to content with embedded HowTo schema markup for rich result eligibility.

Write a how-to guide on '{how_to_topic}' for {domain} targeting the query '{target_keyword}'. Structure the content with a brief introduction, 5-9 numbered steps each under 80 words, required tools/materials list, and embed complete HowTo schema JSON-LD. Optimize for featured snippet and rich result eligibility...
contenthow-toschema
Audit v1.0

Schema Type Coverage Gap Audit

Maps which schema.org types are missing across page templates for a given site.

Review the following page templates and their current schema markup: {template_schema_json}. Identify schema.org types that are eligible but absent for each template, prioritized by rich-result eligibility and search volume impact...
auditschemarich-results
Ranking v1.0

SERP Volatility Cause Finder

Diagnoses root causes of ranking volatility for a target keyword set over a defined period.

Given the following rank tracking data showing volatility for {keyword_list} over the past {time_period}: {rank_data_csv}, cross-reference with Google algorithm update dates, SERP feature changes, and competitor content updates. Hypothesize the primary volatility driver for each keyword group and recommend stabilization actions...
rankingserp-volatilityalgorithm
Technical v1.0

Sitemap Index Split Engineer

Designs a scalable sitemap index architecture split by content type and crawl priority.

Design a sitemap index structure for {domain} with {total_url_count} URLs across the following content types: {content_type_list}. Split child sitemaps by content type and priority tier, apply lastmod and priority attributes strategically, ensure no sitemap exceeds 50,000 URLs or 50MB, and output the complete XML sitemap index file with submission instructions...
technicalsitemapcrawl
GEO v1.0

AI Overview Query Eligibility Tester

Evaluates whether a target query set is likely to trigger AI Overview responses.

For the following keyword list {keyword_list} targeting {domain}, assess each query against known AI Overview trigger patterns (informational intent, question format, medical/financial topics, etc.), score each for AI Overview likelihood, and recommend content adjustments to improve inclusion odds...
geoai-overviewquery-intent
GEO v1.0

Brand Mention Coverage Map

Maps where and how {brand} is mentioned across the web to assess LLM training signal.

Using the brand mention data {mention_data} for {brand}, classify each mention by source type (news, forum, review, wiki, blog), sentiment, and authority tier. Identify coverage gaps by source type compared to {competitor_brand}, and recommend a structured outreach plan to fill gaps...
geobrand-mentionscoverage
Ranking v1.0

Branded Query Click Share Plan

Builds a strategy to maximize CTR and click share on branded SERP real estate.

Using GSC data {gsc_csv} filtered to branded queries for {domain}, identify branded query types (navigational, review, comparison, product), calculate current CTR vs. estimated benchmark, and recommend sitelinks, structured data, and title/meta optimizations to increase total branded click share by {target_percent}%...
rankingbranded-queriesctr
Audit v1.0

Canonical Chain Depth Diagnostic

Detects self-referential, chained, and conflicting canonical tags across a site.

Analyze the canonical tag export {canonical_csv} for {domain}. Identify: (1) canonicals pointing to a URL that itself has a different canonical, (2) canonicals pointing to non-indexable URLs, (3) pages missing canonicals. Output a severity-ranked issue table with corrected canonical values...
auditcanonicaltechnical
GEO v1.0

ChatGPT Source Authority Gap Plan

Identifies authority signals {domain} is missing to appear in ChatGPT-sourced answers.

You are a GEO strategist. For the topic {topic}, ChatGPT currently cites {competitor_sources}. Analyze what authority signals (third-party mentions, structured data, passage depth, recency) those sources have that {domain} lacks, then produce a 90-day action plan to close the gap...
geochatgptauthority
Content v1.0

Content Brief SERP Entity Enricher

Enriches a content brief with SERP-derived entities and semantic terms.

You are a content strategist. For the target keyword {keyword} and the top 10 ranking URLs {serp_urls}, extract the key entities (people, places, organizations, concepts) and semantic terms present across ranking pages. Enrich the draft brief {draft_brief} with a required entities list, NLP term targets, and internal link anchors...
contententitiesbrief
Content v1.0

Content Decay Traffic Impact Scorer

Scores decaying pages by traffic loss magnitude to prioritize refresh investments.

Using GSC data {gsc_csv} and Google Analytics traffic data {ga_csv} for {domain} over the last {timeframe}, identify pages with declining impressions and clicks. Score each by: (1) absolute traffic lost, (2) ranking drop depth, (3) page strategic value. Output a top-20 refresh priority list with recommended intervention type (update, rewrite, merge, or retire)...
contentcontent-decayrefresh
Content v1.0

E-E-A-T Author Bio Content Builder

Creates structured author bio content designed to satisfy E-E-A-T quality signals.

Write a 150-200 word author bio for {author_name} who is a {credentials} specializing in {topic_area}. The bio must include: verifiable credentials, years of experience, publications or notable work, first-hand experience statement, and links to social/professional profiles. Also output Person schema JSON-LD for the bio page...
contente-e-a-tauthor
Content v1.0

FAQ Entity Intent Block Builder

Generates FAQ blocks anchored to entity-based PAA questions for a target page.

For the page targeting {keyword} on {domain}, extract the top People Also Ask questions {paa_list} and related entity questions from knowledge panels. Write concise, schema-ready FAQ answers (50-80 words each) optimized for featured snippet extraction and FAQPage structured data. Include the JSON-LD FAQPage markup block...
contentfaqschema
GEO v1.0

Generative SERP Feature Gap Finder

Identifies which generative SERP features competitors win that {domain} is missing.

For the query set {query_list}, document which generative SERP features (AI Overview, AI Mode cards, Perspectives, Discussions) each competitor {competitor_list} appears in versus {domain}. Identify the content and structural patterns behind competitor inclusions and produce a gap-closing content brief...
geogenerative-serpcompetitor-gap
Technical v1.0

Hreflang Matrix Conflict Resolver

Detects and resolves hreflang signal conflicts across a multilingual site's URL matrix.

Analyze the hreflang implementation export {hreflang_csv} for {domain}. Identify: (1) missing return tags, (2) mismatched locale codes, (3) hreflang pointing to non-canonical URLs, (4) x-default missing. For each issue type, list affected URLs and output corrected hreflang tag sets ready for implementation...
technicalhreflanginternational-seo
Ranking v1.0

Image SERP Gap Opportunity Brief

Identifies image SERP opportunities where {domain} lacks optimized visual assets.

Analyze the image SERP results for {keyword_list}. For each query, document the dominant image types (infographic, product photo, diagram, screenshot), file format, alt text patterns, and page context of ranking images. Compare against {domain}'s image assets and output an image creation and optimization brief...
rankingimage-serpvisual-seo
Audit v1.0

Indexing Coverage Anomaly Audit

Diagnoses unexpected indexing exclusions using GSC coverage data and crawl exports.

Compare the Google Search Console coverage export {gsc_csv} with the crawl export {crawl_csv} for {domain}. For each exclusion reason (Crawled not indexed, Discovered not indexed, Blocked by robots.txt, etc.), count affected URLs, identify the root cause, and recommend a fix with implementation steps...
auditindexinggsc
Content v1.0

Internal Link Anchor Opportunity Map

Finds pages that should link to a target URL and drafts the optimal anchor text.

For the target page {target_url} on {domain} ranking for {target_keyword}, crawl the content of the top {n} highest-traffic pages {source_url_list}. Identify paragraphs containing semantically related text, recommend exact anchor text for each, and output a table of source URL, paragraph excerpt, recommended anchor, and insertion instruction...
contentinternal-linksanchor-text
Technical v1.0

JSON-LD Organization Entity Builder

Generates a complete Organization JSON-LD block to strengthen brand entity signals.

Generate a complete Organization (or LocalBusiness) JSON-LD schema block for {brand} using the following data: {brand_data}. Include all recommended properties: name, url, logo, sameAs (all social and Wikipedia profiles), contactPoint, address, foundingDate, and description. Validate against Google's Rich Results requirements and flag any missing recommended fields...
technicaljson-ldentity
Technical v1.0

LCP Load Chain Optimizer

Maps the LCP element's full resource load chain and eliminates delay bottlenecks.

Analyze the waterfall chart {waterfall_data} and LCP element details {lcp_element_data} for the page {url}. Trace the full load chain from TTFB to LCP element render. Identify all blocking resources, render-blocking scripts, and missing preload hints in the chain. Output a prioritized list of fixes with expected LCP improvement per fix...
technicallcpcore-web-vitals
Audit v1.0

Log File Segment Intent Map

Segments log file bot traffic by URL pattern to surface crawl intent mismatches.

Analyze the following log file sample {log_file_csv} from {domain}. Group URLs by directory pattern, identify which segments Googlebot visits most vs. least, flag segments wasting crawl budget, and recommend robots.txt or internal link changes to fix the distribution...
auditlog-filecrawl-budget
GEO v1.0

Multi-LLM Citation Source Tracker

Compares citation source overlap and divergence across three major LLMs for a topic.

Run the query {query} in ChatGPT, Claude, and Perplexity. Record all cited URLs and sources in the table {results_table}. Identify: (1) sources cited by all three, (2) sources unique to one LLM, (3) {domain}'s presence. Output a strategy to reach the universally cited tier...
geomulti-llmcitations
Ranking v1.0

People Also Ask Intent Gap Planner

Mines PAA questions to find unanswered intent clusters for a target topic.

For the seed keyword {seed_keyword}, extract all People Also Ask questions from the SERP data {paa_data}. Cluster them by intent sub-type, identify which clusters {domain} has no content addressing, and output a content brief outline for the top 3 gap clusters ranked by search volume...
rankingpaacontent-gaps
GEO v1.0

Perplexity Source Ranking Model

Models why Perplexity cites certain sources over {domain} for target queries.

Analyze Perplexity AI responses for the queries {query_list}. For each query, list the cited sources, infer the citation selection signals (recency, domain authority, structured data, passage clarity), compare against {domain}'s content, and output a prioritized list of content changes to improve citation odds...
geoperplexitycitations
Content v1.0

Programmatic Page Schema Template

Designs a scalable content and schema template for a programmatic SEO page type.

You are a programmatic SEO architect. For the page type {page_type} on {domain} (e.g., city landing pages, product comparison pages), design a content template including: required sections with dynamic {variable} slots, recommended Schema.org type and properties, internal linking rules, and uniqueness mechanisms to prevent thin content issues...
contentprogrammatic-seoschema
Audit v1.0

Schema Type Coverage Planner

Maps existing schema types against eligible page templates to find markup gaps.

Given the page templates for {domain}: {template_list}, and the currently implemented schema types {current_schema}, identify every page template missing eligible Schema.org markup, rank gaps by rich-result value, and output a remediation priority table...
auditschemarich-results
Technical v1.0

Schema Markup Generation Brief

Generates a complete schema markup implementation brief for a given page type.

For the {page_type} page at {url} on {domain}, determine the most appropriate Schema.org types and properties. Generate a complete JSON-LD block with all recommended properties populated using the page data {page_data}. Include a validation checklist and note any properties required for rich result eligibility...
technicalschemajson-ld
Technical v1.0

Sitemap Split Priority Engineer

Designs a multi-sitemap architecture with priority and changefreq assignments.

For {domain} with {total_url_count} indexable URLs across page types {page_type_list}, design a sitemap index architecture. Specify how to split URLs across child sitemaps by page type, assign changefreq and priority values based on content update cadence {update_cadence}, and output the sitemap index XML and one example child sitemap XML...
technicalsitemapcrawl
Audit v1.0

Canonical Tag Conflict Resolver

Detects canonical tag conflicts including self-referencing errors, chains, and cross-domain mismatches.

Audit the canonical tags for the following URLs on {domain}: {url_list}. Identify cases where: (1) the canonical points to a redirecting URL, (2) a chain of canonicals exists, (3) the canonical disagrees with the sitemap-declared URL, or (4) cross-domain canonicals lack matching hreflang. Output a conflict table with URL, canonical target, conflict type, and recommended fix...
auditcanonicalindexing
Technical v1.0

CDN Cache Header SEO Optimizer

Audits and optimizes CDN cache-control headers to improve crawl efficiency and TTFB for SEO.

Audit the cache-control and CDN configuration for {domain} on {cdn_provider}. For each content type (HTML pages, CSS, JS, images, fonts), review: current max-age/s-maxage values, Vary header usage, ETag configuration, and stale-while-revalidate settings. Identify pages with no-cache or no-store directives that should be cacheable, and assets with overly short TTLs. Produce a cache header configuration spec optimized for Googlebot TTFB and end-user performance...
technicalcdncache-headers
Ranking v1.0

Competitor Content Gap Rank Mapper

Maps keywords where top competitors rank but the target domain has no indexable content.

Compare the organic keyword rankings of {competitor_domains} against {domain} for the topic area {topic_area}. Identify all keywords where at least two competitors rank in the top 20 but {domain} has no ranking page. Filter results to keywords with monthly search volume above {min_volume}. Output a prioritized opportunity list with keyword, competitor URLs ranking, estimated traffic potential, and recommended content type...
rankingcompetitor-gapkeyword-research
Content v1.0

Content Refresh Priority Impact Scorer

Scores existing content pieces by refresh ROI using traffic, ranking, and freshness signals.

Given the following content inventory for {domain}: {content_list_with_metrics}, score each piece for refresh priority using a weighted formula: current organic traffic (30%), ranking position trend over 90 days (25%), content age vs. topic recency requirements (20%), backlink equity (15%), and conversion rate (10%). Output a ranked refresh queue with the top 20 pages, each annotated with the primary refresh action required (update data, add sections, restructure, or consolidate)...
contentcontent-refreshprioritization
Technical v1.0

Edge SEO Redirect Worker Config

Writes a Cloudflare Worker script to handle SEO-critical redirect rules at the edge.

Write a Cloudflare Worker script for {domain} that handles the following SEO redirect rules at the edge: {redirect_rules_list}. The script must: (1) return HTTP 301 for permanent redirects and 302 for temporary, (2) preserve query parameters unless explicitly excluded, (3) enforce trailing slash consistency ({trailing_slash_policy}), (4) redirect HTTP to HTTPS, and (5) add logging headers for debug tracing. Include a test suite for each redirect rule...
technicaledge-seocloudflare
Content v1.0

FAQ Block Schema Content Generator

Generates on-brand FAQ content with embedded FAQPage schema for a target topic and keyword.

Generate a set of 8 FAQ items for the topic {topic} targeting the keyword cluster {keyword_cluster} for {domain}. Each FAQ must: answer the question in 40–60 words using a direct-answer-first structure, incorporate natural semantic variations of the target keywords, and be written to match {brand_tone} brand voice. After generating the FAQ content, produce the complete JSON-LD FAQPage schema block ready for implementation...
contentfaqschema
GEO v1.0

Generative SERP Source Preference Analyzer

Analyzes which source types generative SERPs prefer for a topic and maps content requirements.

For the topic area {topic_area} and these 10 seed queries {query_list}, observe AI Overview and Perplexity source selections. Categorize preferred sources by: domain type (publisher, brand, academic, wiki), content format (listicle, how-to, data study, explainer), recency (published within 6/12/24 months), and topical specificity. Produce a source preference profile and translate it into content creation guidelines for {domain}...
geogenerative-serpsource-preference
Audit v1.0

Internal Link Depth Distribution Checker

Reviews internal link depth across the site to ensure priority pages are reachable within three clicks.

Using the crawl data for {domain}, calculate the click depth of every indexed URL from the homepage. Identify all pages beyond three clicks deep that have organic traffic or backlinks. For each, recommend a linking path to reduce depth to three or fewer clicks, specifying which parent page should carry the new link and appropriate anchor text...
auditinternal-linkscrawl-depth
Technical v1.0

JSON-LD Breadcrumb Schema Spec

Generates valid BreadcrumbList JSON-LD for a site's URL hierarchy and page templates.

For the website {domain} with the following URL hierarchy: {url_hierarchy}, generate valid JSON-LD BreadcrumbList schema for each page template (homepage, category, subcategory, product/article). Ensure each ListItem includes: position (integer), name (human-readable label), and item (canonical URL). Validate that the breadcrumb path matches the visual breadcrumb on-page. Output one schema block per template with implementation notes for the CMS {cms_name}...
technicalschemajson-ld
GEO v1.0

LLM Brand Mention Context Audit

Audits how LLMs contextually describe a brand and flags inaccurate or missing attribute associations.

Query ChatGPT, Claude, and Perplexity with the prompt: 'Describe {brand_name} and what it offers.' Extract each model's description and compare against the brand's official positioning on {website_url}. Identify: (1) factual inaccuracies, (2) missing key attributes (products, differentiators, geography), (3) outdated claims, and (4) competitor conflation. Produce a correction brief with on-site and off-site remediation steps...
geobrand-mentionllm-accuracy
Audit v1.0

Log File Segment Opportunity Audit

Analyzes server log segments to surface crawl inefficiencies and Googlebot behavior patterns.

Given the following server log data for {domain} covering {date_range}, segment Googlebot requests by URL type (HTML, CSS, JS, images), identify URLs crawled most frequently vs. least, flag 4xx/5xx response rates, and surface crawl budget waste opportunities. Output a markdown table with URL pattern, crawl frequency, status code distribution, and recommended action...
auditlog-filecrawl-budget
GEO v1.0

Multi-LLM Answer Consistency Tester

Tests how consistently multiple LLMs represent a brand across identical prompts.

Run the following prompt across ChatGPT, Claude, Gemini, and Perplexity: '{test_prompt}'. Record each model's response verbatim. Analyze: (1) whether {brand_name} is mentioned in each, (2) the sentiment and accuracy of each mention, (3) which competitors are mentioned instead, and (4) what signal differences might explain the variance. Output a consistency matrix and a gap-closing brief...
geomulti-llmbrand-visibility
Audit v1.0

Orphan Page Link Gap Planner

Identifies orphan pages and recommends internal link insertions to restore crawl access.

Using the following crawl export for {domain}, identify all pages that receive zero internal links (orphan pages). For each orphan URL, suggest the three most contextually relevant existing pages where an internal link should be inserted, provide anchor text recommendations, and rank orphans by estimated traffic potential. Output as a CSV with columns: orphan_url, suggested_linking_page, anchor_text, priority_score...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Intent Gap Explorer

Mines People Also Ask boxes for intent gaps and maps them to content creation opportunities.

For the seed query {seed_query} and its top 5 SERP results, collect all People Also Ask questions (up to 3 expansion levels). Cluster the questions by sub-topic intent. Identify which question clusters {domain} has no existing content for, which we partially cover, and which we rank for. Prioritize the top 10 unaddressed PAA questions by estimated search volume and produce a brief for each recommending content type, format, and target URL...
rankingpaacontent-gaps
Technical v1.0

Robots.txt Crawl Priority Optimizer

Rewrites robots.txt directives to maximize crawl budget allocation toward priority content.

Review the current robots.txt for {domain}: {robots_txt_content}. Identify: (1) URL patterns being unnecessarily crawled (parameter URLs, session IDs, admin paths, duplicate facet combinations), (2) valuable content patterns being accidentally blocked, and (3) missing Crawl-delay or sitemap declarations. Produce an optimized robots.txt with inline comments explaining each Disallow directive, and list the estimated crawl budget recovered by each change...
technicalrobots-txtcrawl-budget
Ranking v1.0

SERP Volatility Cause Analyzer

Diagnoses the likely causes of ranking volatility for a set of URLs across a given time window.

Analyze the ranking fluctuation data for {domain} URLs {url_list} over the period {date_range}. Correlate volatility spikes with: confirmed Google algorithm updates, competitor content changes, backlink profile changes, technical crawl incidents, and on-page modifications logged in {change_log}. For each volatile URL, assign a most-likely cause and a stabilization recommendation...
rankingserp-volatilityalgorithm
Content v1.0

Schema Rich How-To Content Spec

Drafts a how-to article with embedded HowTo schema structured for rich result eligibility.

Write a how-to article for the task: {how_to_task} targeting the keyword {target_keyword} for {domain}. Structure the article with: a direct-answer introduction (under 60 words), 5–8 numbered steps each with a descriptive heading, optional tips and warnings blocks, and a closing FAQ section. After drafting, generate the complete JSON-LD HowTo schema block including name, description, totalTime, estimatedCost if applicable, and all Step objects with text and image properties...
contenthow-toschema
Content v1.0

Topic Cluster Hub Spoke Content Map

Maps a full hub-and-spoke topic cluster with pillar and supporting page specs.

Design a hub-and-spoke content cluster for the pillar topic {pillar_topic} for {domain}. Identify the primary hub page URL and target keyword. Then generate 8–12 spoke page topics, each covering a distinct sub-topic with unique target keyword, recommended content format, word count, internal link anchor back to hub, and 2–3 cross-links to sibling spoke pages. Output the full cluster map as a table and include a recommended publication sequence...
contenttopic-clusterscontent-architecture
GEO v1.0

AEO Question Depth Coverage Brief

Maps the full question graph around a topic to guide AEO content depth for AI engine eligibility.

Build a comprehensive AEO question-depth map for the topic {topic}. List every primary, secondary, and follow-up question an AI engine might answer, cluster them by intent stage, and recommend the minimum answer length and supporting entity set for each cluster to maximize AI engine citation...
geoaeotopical-authority
GEO v1.0

AI Mode Query Cluster Visibility Plan

Plans content and entity optimizations to improve brand visibility within Google AI Mode query clusters.

Analyze the Google AI Mode response for queries in the cluster {query_cluster}. Identify which sources are consistently surfaced, what entity relationships they express, and how {site_url} content must be restructured to appear within AI Mode answer panels for this cluster...
geoai-modeentity
GEO v1.0

AI Overview Passage Source Gap

Finds which passage-level content gaps prevent a page from being sourced in Google AI Overviews.

For the query {target_query}, retrieve the current AI Overview and identify every factual claim or sub-question it answers. Map each claim against the content of {page_url} and list the specific passage additions needed to make the page a viable AI Overview source...
geoai-overviewpassage
GEO v1.0

Brand Mention Context Gap Analysis

Audits the context surrounding brand mentions in LLM outputs to identify missing associative signals.

Collect 20 LLM-generated responses mentioning {brand_name} across queries in the {industry} space. Analyze the context words and entities co-occurring with the brand, identify missing positive associations versus top competitors, and output a content brief to close the context gap...
geobrand-mentionentity
GEO v1.0

ChatGPT Entity Citation Readiness Score

Scores a brand's entity signals to estimate readiness for citation in ChatGPT-generated answers.

Evaluate the entity citation readiness of {brand_name} for ChatGPT responses about {topic}. Score entity prominence, corroboration across authoritative sources, Knowledge Graph presence, and structured data quality on a 1–10 scale, then list the top five actions to improve citation probability...
geochatgptentity
Content v1.0

Content Brief Topical Depth Builder

Generates a comprehensive content brief with topical depth requirements derived from SERP analysis.

Create a detailed content brief for the target keyword {keyword}. Analyze the top 10 ranking pages and extract: required subtopics, average word count by section, entities that must be present, semantic terms, and E-E-A-T signals. Format as a structured brief a writer can execute immediately...
contentbrieftopical-authority
Content v1.0

Content Gap SERP Competitor Brief

Identifies high-volume queries where competitors rank but the target site has no content, producing a creation brief.

Compare the ranking keyword sets for {competitor_domain} and {my_domain} in the {niche} vertical. Identify queries where the competitor ranks in positions 1–10 and the target site has no ranking content. For the top 10 gap opportunities, produce a one-paragraph content creation brief per query...
contentcontent-gapcompetitor
Content v1.0

Content Outline SERP Entity Enricher

Enriches a draft content outline with entities and semantic terms extracted from top-ranking SERP pages.

Given the draft outline for {article_title}, analyze the top 5 Google results for {target_keyword} and extract named entities, supporting concepts, and LSI terms not present in the outline. Insert each enrichment at the most contextually appropriate outline section and explain the SEO rationale...
contententityoutline
Audit v1.0

Core Web Vitals CrUX Segment Finder

Breaks down CrUX field data by device and connection type to isolate the worst-performing user segments.

Using the CrUX API data for {origin_or_url}, segment INP, LCP, and CLS scores by phone vs. desktop and 4G vs. slower connections. Identify which segment × metric combination fails Core Web Vitals thresholds and output a ranked remediation checklist...
auditcore-web-vitalscrux
Audit v1.0

Duplicate Content Facet Parameter Audit

Identifies URL parameter combinations from faceted navigation creating duplicate or near-duplicate pages.

Given the URL parameter inventory for {site_url}, identify which parameter combinations produce near-duplicate content, calculate estimated duplicate page volume, and recommend the correct combination of canonical tags, robots directives, and URL parameter tools to consolidate signals...
auditduplicate-contentfaceted-nav
Content v1.0

FAQ Schema Intent Cluster Generator

Generates FAQ schema content blocks by clustering PAA and voice search questions around a target page.

For the page {page_url} targeting {primary_keyword}, collect the top 15 PAA questions from related SERPs and voice search query variants. Group them into 3–5 intent clusters, write a concise 40–60 word answer for each, and output the complete FAQPage JSON-LD block ready for implementation...
contentfaqschema
Audit v1.0

Hreflang Return Tag Parity Checker

Validates that every hreflang annotation has a correct reciprocal return tag to prevent signal conflicts.

Review the hreflang tag export for {site_url} below. For each locale pair, verify the return tag is present and syntactically correct on the target page. Output a table of missing or mismatched return tags with the exact corrected hreflang strings...
audithreflanginternational
Ranking v1.0

Knowledge Panel Entity Attribute Planner

Identifies missing or incorrect entity attributes that prevent a full Knowledge Panel from appearing.

Audit the Google Knowledge Panel for {entity_name}. List every attribute currently displayed, every attribute shown for direct competitors but missing for this entity, and produce a structured action plan covering Wikipedia edits, Wikidata entries, and on-site structured data to fill each gap...
rankingknowledge-panelentity
Audit v1.0

Log File Bot Crawl Prioritizer

Analyzes server log files to reveal which bots crawl which URLs and surface crawl budget inefficiencies.

Given the server log excerpt below for {site_url}, identify which Googlebot user-agent variants are crawling which URL patterns most frequently, flag low-value URLs consuming disproportionate crawl budget, and recommend directives to reclaim budget for high-priority pages...
auditlog-filecrawl-budget
Content v1.0

Meta Description Batch Rewrite Brief

Batch-rewrites meta descriptions for low-CTR pages using query intent and value proposition signals.

For each page in {page_list} with a GSC CTR below {threshold}%, analyze the target query intent and current meta description. Rewrite each meta description to be 150–160 characters, include the primary keyword naturally, add a clear value proposition or call to action, and output a CSV with columns: URL, old description, new description...
contentmeta-descriptionctr
Audit v1.0

Orphan Page Revenue Impact Audit

Finds orphan pages with no internal links and estimates the revenue risk of leaving them undiscovered.

Using the crawl data and analytics export for {site_url}, identify all pages receiving organic traffic but having zero internal inbound links. Score each orphan by monthly sessions × average conversion rate and output a prioritized re-linking plan...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Question Expansion Miner

Extracts and clusters PAA questions from a seed query set to surface content and FAQ opportunities.

For each seed query in {seed_queries}, extract the first 5 levels of People Also Ask questions from Google SERPs. Cluster the resulting questions by sub-topic, score each cluster by question volume, and output a prioritized content and FAQ schema addition plan for {site_url}...
rankingpaafaq
Technical v1.0

Schema Markup JSON-LD Product Builder

Generates complete, valid Product JSON-LD schema markup from a product data input for rich result eligibility.

Using the product data provided below for {product_name}, generate a complete and valid JSON-LD Product schema block including name, description, image, brand, offers (price, currency, availability), aggregateRating, and review properties. Validate against Schema.org and Google's rich result requirements...
technicalschemajson-ld
Ranking v1.0

SERP Intent Type Cluster Map

Classifies a keyword list by SERP intent type and groups them into actionable targeting clusters.

For the keyword list {keyword_list}, classify each query as informational, navigational, commercial, or transactional based on current SERP feature mix (ads, featured snippets, maps, shopping). Group keywords into intent clusters and recommend the correct page type and content format for each cluster...
rankingintentkeyword
Ranking v1.0

Video SERP Schema Visibility Planner

Plans VideoObject schema and thumbnail optimizations to capture video SERP carousels and rich results.

For the video content at {video_url}, evaluate its current VideoObject schema implementation, thumbnail quality, transcript availability, and page context signals. Produce a step-by-step plan to maximize video SERP carousel eligibility and estimated click-through uplift...
rankingvideo-serpschema
Audit v1.0

Canonical Conflict Resolution Audit

Detects self-referencing canonical errors, cross-domain conflicts, and canonical chains site-wide.

Audit the canonical tag implementation for {site_url} using the crawl data provided: {crawl_export}. Identify: pages with conflicting canonical signals (HTTP header vs. HTML tag), canonical chains longer than one hop, canonicals pointing to non-indexable URLs, paginated pages missing rel=next signals, and parameter URLs with missing canonicals. Output a fix-priority table...
auditcanonicaltechnical
GEO v1.0

Brand Mention Context Gap Auditor

Audits the surrounding context of brand mentions across LLM outputs to detect sentiment or topic drift.

Collect 20 LLM-generated responses mentioning {brand_name} across queries in {topic_cluster}. For each mention, classify: sentiment (positive/neutral/negative), topic context, whether the brand is the primary or secondary subject, and factual accuracy. Identify context patterns that could harm citation quality and recommend content or PR actions to correct drift...
geobrand-mentionaudit
Ranking v1.0

Competitor SERP Gap Rank Mapper

Finds keywords where competitors rank in positions 1-10 but your site is absent or beyond page 2.

Using the keyword ranking data for {site_url} and competitors {competitor_domains}, identify all keywords where at least two competitors rank in positions 1-10 but {site_url} ranks below position 20 or does not rank at all. Cluster these gap keywords by topic and search volume. For each cluster, output: gap size, top competitor URL, content format, and recommended content action...
rankingcompetitorgap-analysis
Audit v1.0

Core Web Vitals CrUX Segment Planner

Breaks down CrUX field data by device and connection type to isolate failing CWV segments.

Analyze the CrUX field data for {site_url} and segment LCP, INP, and CLS scores by device type (mobile/desktop) and effective connection type (4G, 3G, 2G). Identify which segments fall in the 'needs improvement' or 'poor' thresholds, rank them by traffic share impact, and for each failing segment suggest the most likely root cause and remediation...
auditcore-web-vitalscrux
Ranking v1.0

Image SERP Optimization Planner

Builds an image SEO plan to capture more image SERP real estate for target visual queries.

For the target visual queries {visual_query_list} relevant to {site_url}, analyze the top 10 image SERP results per query. Identify patterns in: file naming conventions, alt text structure, surrounding context text, page authority of ranking pages, image dimensions, and schema markup. Produce a structured optimization plan for {site_url}'s image assets to compete for image SERP positions...
rankingimage-serpvisual-search
Ranking v1.0

Knowledge Panel Entity Signal Audit

Audits the entity signals needed to trigger and control a brand knowledge panel on Google.

Audit the knowledge panel eligibility and signal completeness for {brand_name}. Check: Wikidata entity record completeness, Wikipedia page existence, sameAs markup on website, Google Business Profile status, structured data on homepage, consistent brand attributes across top 20 citation sources, and social profile completeness. Score each signal and output a knowledge panel acquisition roadmap...
rankingknowledge-panelentity
GEO v1.0

Multi-LLM Answer Gap Analyzer

Surfaces content gaps by comparing {brand} citation patterns across ChatGPT, Claude, and Perplexity.

For the query set {query_list}, collect answers from ChatGPT, Claude, and Perplexity and record whether {brand_name} is cited, mentioned, or absent in each. Build a gap matrix showing LLM-by-query citation presence. For every cell where {brand_name} is absent, identify the content type or authority signal most likely responsible and recommend a fix...
geomulti-llmcitation
Technical v1.0

Prerendering SEO Eligibility Config

Determines which URLs qualify for prerendering and outputs a dynamic rendering configuration spec.

Evaluate the prerendering eligibility of each page template for {site_url}: {page_template_list}. For each template, assess: JavaScript dependency level, dynamic content personalization, user-state variation, and Googlebot agent detection risk. Classify each as: full SSR, static prerender, dynamic rendering with caching, or client-side only. Output a configuration spec for {prerender_tool} (e.g., Rendertron, Prerender.io)...
technicalprerenderingrendering
Ranking v1.0

SERP Volatility Cause Diagnoser

Diagnoses the likely cause of ranking volatility for a URL using SERP feature and algorithm change signals.

The URL {url} targeting {target_keyword} has shown ranking volatility in the following GSC data: {gsc_position_history}. Analyze the position changes against: known Google algorithm update dates, SERP feature changes (featured snippet, AI Overview, PAA expansion), competitor content changes, and your own site change log {site_change_log}. Produce a cause-probability assessment and stabilization plan...
rankingvolatilityalgorithm
Technical v1.0

XML Sitemap Health Split Spec

Designs a sitemap index architecture that segments URLs by type and ensures only indexable URLs are included.

Design a sitemap index architecture for {site_url} with {total_url_count} URLs. Create a specification for splitting into child sitemaps by URL type: blog posts, product pages, category pages, landing pages, and news articles. For each child sitemap, define: inclusion criteria (indexable, canonical, HTTP 200 only), exclusion rules, update frequency, priority values, and the sitemap index file structure. Output as a complete technical spec with example XML...
technicalsitemaparchitecture
Ranking v1.0

Competitor Content Gap Rank Finder

Finds keywords where top competitors rank but your site has no page, sized by traffic opportunity.

Using the following keyword ranking export for {your_domain} and up to three competitors ({competitor_domains}): {keyword_data}, identify all keywords where at least two competitors rank in positions 1-20 but {your_domain} has no ranking URL. Filter to keywords with monthly search volume above {min_volume}. Produce a prioritized gap table with keyword, competitor URLs, estimated traffic opportunity, and recommended content type...
rankingcompetitor-gapkeywords
Technical v1.0

Cloudflare Worker SEO Rule Spec

Writes Cloudflare Worker JavaScript to implement edge SEO rules including redirects, header injection, and bot detection.

Write a Cloudflare Worker script for {site_url} that implements the following edge SEO rules: (1) 301 redirect the URL patterns in {redirect_map} at the edge without hitting the origin, (2) inject the following HTTP headers on all HTML responses: {header_rules}, (3) detect and serve pre-rendered content to the following bot user-agents: {bot_ua_list}. Include error handling and a request logging stub...
technicaledge-seocloudflare
Content v1.0

Content Gap Topic Seed Finder

Discovers content topic gaps by comparing competitor ranking pages against existing site content inventory.

Compare the full content inventory of {site_url} against the ranking pages of {competitor_domains} for the topic area {topic_area}. Use the following crawl and ranking data: {data}. Identify subtopics, question formats, and content types that competitors rank for but {site_url} has not published. Prioritize gaps by estimated traffic opportunity and group into a recommended content calendar...
contentgap-analysiscompetitor
GEO v1.0

Generative SERP Freshness Signal Plan

Creates a content freshness maintenance plan to sustain LLM citation and generative SERP inclusion over time.

Design a freshness signal maintenance plan for {your_domain} targeting sustained inclusion in generative SERP features and LLM citations for the topic area {topic}. Include: recommended update frequency by content type, freshness signals to embed (date stamps, version numbers, data refresh markers), re-promotion channels, and a quarterly review checklist to detect and reverse citation decay...
geofreshnessgenerative-serp
GEO v1.0

Entity Association Salience Mapper

Maps entity co-occurrence strength between a brand and key topical entities across the web and LLM outputs.

Analyze the entity association profile of {brand_name} in relation to the following target entities: {entity_list}. For each pair, assess co-occurrence frequency in search results, Wikipedia, and LLM outputs, and score salience on a 1-10 scale. Recommend specific content, link acquisition, or PR actions to strengthen the weakest associations...
geoentitysalience
Audit v1.0

Hreflang Return Tag Matrix Verifier

Verifies bidirectional hreflang return tag consistency across all locale variants of a page set.

Given the following hreflang tag data extracted from {site_url} for the page set {page_set}: {hreflang_data}, verify that every declared locale variant contains a valid reciprocal return tag. Produce a matrix showing which locale-pairs are correctly cross-referenced and flag any missing, mismatched, or self-referencing errors with their exact URL and attribute value...
audithreflanginternational
Audit v1.0

Indexing Anomaly Diagnosis Brief

Diagnoses sudden indexing drops by correlating Search Console coverage data with site change events.

You are an SEO diagnostician. The following Search Console indexing coverage report shows a significant drop in indexed pages for {site_url} beginning on {date}: {coverage_data}. Cross-reference with the site change log: {change_log}. Identify the most likely root cause categories (robots, noindex, canonical, crawl error, manual action), rank by probability, and prescribe a verification test for each...
auditindexingsearch-console
Audit v1.0

Internal Link Depth Audit Runner

Measures click depth of priority pages from the homepage and flags those buried beyond three clicks.

Using the crawl data below for {site_url}: {crawl_export_csv}, calculate the click depth of every URL from the homepage. Flag all pages with a click depth greater than 3 that have non-zero organic impressions. For each flagged page, recommend the shortest path to reduce click depth and identify the best intermediate page to add a linking shortcut...
auditinternal-linkscrawl
Ranking v1.0

PAA Intent Cluster Expansion

Mines People Also Ask data to build an intent cluster map and FAQ content recommendations for a topic.

Starting with the seed keyword {seed_keyword}, collect the first three levels of People Also Ask expansion in Google SERPs. Categorize each question by intent sub-type (definitional, comparative, how-to, when, troubleshooting). Group into intent clusters and for each cluster, recommend a content format (standalone FAQ section, dedicated page, or inline answer block) and a target URL on {site_url}...
rankingpaaintent
Audit v1.0

Schema Audit Coverage Type Gap

Audits existing schema markup across page types and surfaces missing schema opportunities by template.

Review the following list of page templates and their current schema markup for {site_url}: {template_schema_list}. Identify which structured data types are missing per template, which types Google's Rich Results documentation recommends for each page type, and produce a prioritized implementation gap table...
auditschemarich-results
Ranking v1.0

SERP Intent Mismatch Fix Planner

Detects ranking pages misaligned with SERP intent type and produces content restructuring recommendations.

Analyze the following pages from {site_url} that rank on page 2-3 for their target keywords: {page_keyword_list}. For each, classify the SERP intent type (informational, navigational, commercial, transactional) of the target keyword and compare it to the current page format and content type. For every mismatch, prescribe the content restructuring needed to align with dominant SERP intent...
rankingintentserp
Technical v1.0

XML Sitemap Index Split Planner

Designs a sitemap index architecture that segments URLs by type and priority for optimal crawl signaling.

Design a sitemap index structure for {site_url} with approximately {total_url_count} indexable URLs across the following page type categories: {page_type_list}. Produce a sitemap index file spec that splits URLs into child sitemaps by page type, assigns lastmod and changefreq values per type based on update cadence, stays within the 50,000 URL and 50MB per sitemap file limits, and includes a submission and monitoring plan for Google Search Console...
technicalsitemapcrawl
GEO v1.0

AI Mode Query Cluster Mapper

Maps query clusters where Google AI Mode surfaces content and identifies content format requirements per cluster.

For the topic area {topic}, identify query clusters where Google AI Mode is currently generating responses. For each cluster, document: the content format patterns in cited sources, entity requirements, and the structural gaps in {domain}'s current content that prevent AI Mode inclusion...
geoai-modequery-cluster
GEO v1.0

AI Overview Passage Score Audit

Evaluates page passages for AI Overview inclusion eligibility based on clarity, entity coverage, and format.

Analyze the following page content for {url}. Score each passage (200–400 words) on its likelihood of being selected for a Google AI Overview, evaluating: directness of answer, entity completeness, citation-friendly formatting, and E-E-A-T signals. Output a ranked passage list with improvement recommendations...
geoai-overviewpassage-scoring
Audit v1.0

Canonical Self-Reference Audit

Reviews canonical tags site-wide to detect missing, self-referencing, or conflicting canonical implementations.

Audit the following list of canonical tag implementations for {domain}: {canonical_data_csv}. Identify pages with missing canonicals, non-self-referencing canonicals that conflict with hreflang signals, and canonicals pointing to non-indexable URLs. Output a severity-ranked fix list...
auditcanonicalindexing
GEO v1.0

Citation Context Pre-Publish Checker

Checks a draft piece of content against GEO citation signals before publishing to maximize LLM pickup.

Review the following draft content for {url_or_title}: {content_draft}. Before publication, evaluate it against GEO citation criteria: passage retrievability, entity completeness, statistical claim sourcing, author signal presence, and structural formatting for LLM extraction. Output a pre-publish GEO checklist with pass/fail per criterion...
geocitationpre-publish
Content v1.0

Content Outline Competitor Signals

Generates a content outline enriched with heading and entity signals extracted from top-ranking competitor pages.

Analyze the top 5 ranking pages for {target_keyword} and extract their heading structures, key entities, and unique subtopics covered. Synthesize a superior content outline for {domain} that incorporates all shared signals, adds differentiated sections missing from all competitors, and includes recommended internal link placements...
contentoutlinecompetitor
Audit v1.0

Faceted Nav Parameter Waste Finder

Audits faceted navigation URL parameters to identify crawl budget waste and duplicate indexation risks.

Analyze the following faceted navigation parameter combinations and their crawl frequency data for {domain}: {parameter_crawl_csv}. Identify which parameter combinations produce near-duplicate pages, waste crawl budget, and should be blocked via robots.txt or canonical, versus which should remain indexable...
auditfaceted-navcrawl-budget
Content v1.0

FAQ Entity Intent Content Builder

Generates FAQ content blocks aligned to PAA and entity queries, formatted for FAQ schema markup.

Generate a FAQ content block for the topic {topic} on {domain}. Source questions from People Also Ask data, related searches, and entity-based queries. Write concise answers (40–60 words each) optimized for featured snippet extraction. Format output as valid FAQ schema JSON-LD ready for implementation alongside the rendered HTML block...
contentfaqschema
Technical v1.0

INP Interaction Delay Fix Spec

Diagnoses high INP scores by tracing interaction event processing delays and prescribes JavaScript optimization fixes.

Diagnose the high INP score on {url} using the following interaction trace data: {inp_trace_data}. Identify the specific interactions (click, keypress, tap) causing delays above 200ms. For each, trace the delay to its source: long tasks, input delay, processing time, or presentation delay. Provide specific JavaScript optimization fixes including task yielding, event handler debouncing, and third-party script deferral...
technicalinpcore-web-vitals
Ranking v1.0

Local Pack Competitor Signal Mapper

Benchmarks local pack ranking signals against top competitors for a target location and keyword.

For the local query {keyword} in {location}, analyze the top 3 Google local pack results versus {business_name}. Compare: GBP completeness, review count and recency, citation consistency, proximity factors, and on-page local signals. Output a gap matrix with prioritized actions to improve local pack ranking...
rankinglocal-packlocal-seo
Audit v1.0

Log File Bot Segment Deep Dive

Analyzes server log data to segment bot activity by crawler type and surface crawl inefficiencies.

Analyze the following server log data for {domain} and segment all bot activity by crawler (Googlebot, Bingbot, GPTBot, etc.). Identify which URLs are over-crawled vs. under-crawled, flag wasted crawl budget, and recommend log-based optimizations...
auditlog-filecrawl-budget
GEO v1.0

Multi-LLM Citation Variance Tester

Tests how citation frequency and source preference vary for the same query across multiple LLMs.

For the query {query}, record and compare citation sources returned by ChatGPT, Claude, Perplexity, and Gemini. Identify which domains are universally cited, which are LLM-specific, and which are absent from {domain}. Output a variance matrix and GEO optimization recommendations...
geomulti-llmcitation
GEO v1.0

Perplexity Citation Source Gap

Identifies why competitor pages are cited by Perplexity for target queries while your pages are not.

For the query set {query_list}, compare Perplexity citations for {domain} versus competitors {competitor_domains}. Identify structural, semantic, and authority-based reasons competitors are cited more frequently, and produce a prioritized content and authority gap action plan...
geoperplexitycitation
Content v1.0

Programmatic Content Cluster Seeder

Seeds a programmatic content strategy by generating templated content variation logic for a keyword cluster.

Design a programmatic content seeding strategy for the keyword pattern {keyword_pattern} targeting {location_or_entity_list}. Define: the URL template structure, dynamic variable slots, minimum unique content requirements per page, shared boilerplate limits, internal linking rules between pages, and schema markup template. Include a sample rendered page for one entity...
contentprogrammatictemplate
Content v1.0

Schema How-To Content Drafter

Drafts step-by-step how-to content pre-formatted for HowTo schema markup and rich result eligibility.

Write a how-to article for the task {task_title} targeting the keyword {target_keyword}. Structure the content with a brief intro, a clearly numbered step sequence (6–10 steps), and a summary. Format the output simultaneously as: (1) publication-ready HTML with proper heading hierarchy, and (2) a complete HowTo schema JSON-LD block with name, step, and image placeholders for each step...
contenthow-toschema
Ranking v1.0

SERP Intent Page Type Mapper

Maps dominant SERP intent signals to the correct page type required to rank for a given keyword set.

Analyze the top 10 SERP results for each keyword in {keyword_list}. For each keyword, classify the dominant intent (informational, navigational, commercial, transactional), identify the winning page type (blog, category, product, tool, etc.), and flag where {domain}'s current ranking page mismatches the dominant intent...
rankingintentserp
Audit v1.0

Technical Site Crawl Deep Audit

Generates a structured checklist for a full technical site crawl covering depth, status codes, and indexability.

You are an SEO engineer. Perform a deep technical crawl audit for {domain}. List every issue found across crawl depth, HTTP status codes, redirect chains, and indexability, grouped by severity (critical, high, medium, low), with recommended fixes for each...
auditcrawltechnical
Content v1.0

Topic Cluster Spoke Page Planner

Plans the full set of spoke pages needed to build topical authority around a pillar topic.

Design a complete topic cluster architecture for the pillar topic {pillar_topic} for {domain}. Identify all spoke page topics needed to achieve topical authority, classify each spoke by intent type, estimate target word count, recommend the internal linking flow between hub and spokes, and flag which existing pages can be repurposed versus created from scratch...
contenttopic-clusterpillar
Technical v1.0

XML Sitemap Index Health Spec

Engineers a sitemap index architecture with correct segmentation, lastmod signals, and submission strategy.

Design a complete XML sitemap index architecture for {domain}. Segment sitemaps by content type (pages, posts, products, images, video, news). Define URL inclusion/exclusion rules, lastmod update logic, priority and changefreq guidance, maximum URL limits per file, and a Google Search Console submission and monitoring plan...
technicalsitemapindexing
GEO v1.0

AI Overview Content Gap Scorer

Scores content gaps that prevent {domain} from being cited in AI Overviews for target queries.

For each query in {query_list}, retrieve the current AI Overview response and compare the cited sources against content on {domain}. Score each gap on topical depth, entity coverage, and format alignment, then produce a prioritized content improvement plan to increase AI Overview citation likelihood...
geoai-overviewcontent-gap
Content v1.0

Anchor Text Diversity Optimizer

Audits and rebalances the internal anchor text profile for {target_url} to eliminate over-optimization.

Analyze all internal links pointing to {target_url} across {domain}. Categorize anchors by type: exact match, partial match, branded, naked URL, and generic. If exact-match anchors exceed 40% of the total, generate a rebalancing plan listing which anchor texts to change, suggested alternatives, and the source pages requiring edits...
contentanchor-textinternal-links
Ranking v1.0

Competitor Content Rank Gap Mapper

Maps all keywords where competitors rank in top 10 but {domain} does not, grouped by opportunity size.

Using the keyword ranking exports for {domain} and competitors {competitor_list}, identify all keywords where at least one competitor ranks in positions 1–10 and {domain} ranks outside the top 20 or not at all. Group gaps by topic cluster, estimate traffic opportunity, and recommend whether to create new content or consolidate existing pages...
rankingcompetitor-gapkeywords
Content v1.0

Content Brief SERP Format Match

Generates a content brief that matches the exact SERP format pattern winning for {target_keyword}.

Analyze the top 5 organic results for {target_keyword}. Extract the dominant content format, average word count, heading structure, entity density, and SERP feature types present. Generate a full content brief for {domain} that mirrors the winning format while differentiating on depth, freshness, and E-E-A-T signals...
contentbriefserp
Content v1.0

Content Gap Cluster Opportunity Finder

Identifies full topic clusters where {domain} has zero coverage but competitors rank across all spoke pages.

Compare the keyword ranking footprint of {domain} against {competitor_list}. Identify complete topic clusters where competitors have both a ranking hub page and 3+ ranking spoke pages, but {domain} has no ranking content in the cluster. For each gap cluster, estimate total traffic opportunity and recommend a cluster launch sequence...
contentcontent-gapclusters
Audit v1.0

Core Web Vitals CrUX Deep Dive

Diagnoses CrUX field data failures across device segments and page types for {domain}.

Given the CrUX API data and PageSpeed Insights reports for {domain} below, segment LCP, INP, and CLS failures by device type (mobile vs desktop) and page template. For each failing segment, identify the primary contributing element and recommend a specific code-level fix...
auditcore-web-vitalscwv
Audit v1.0

Faceted Navigation Indexing Audit

Identifies faceted URL patterns that should be blocked, canonicalized, or indexed for {domain}.

Review the faceted navigation URL patterns from the crawl of {domain} below. For each parameter combination, classify it as: (a) index-worthy with unique demand, (b) canonical to a parent category, or (c) block via robots.txt. Provide a decision matrix with rationale and implementation directive for each pattern...
auditfaceted-navcrawl-budget
Ranking v1.0

Featured Snippet Format Targeter

Identifies the optimal snippet format for each target keyword and rewrites content to capture position zero.

For each keyword in {keyword_list}, retrieve the current featured snippet (if any) and classify its format (paragraph, numbered list, table, or none). For keywords where {domain} ranks in positions 2–10 without a snippet, rewrite the relevant content passage in the exact format Google is already rewarding for that query type...
rankingfeatured-snippetserp
Ranking v1.0

Keyword Cannibalization Intent Splitter

Resolves keyword cannibalization by splitting pages along intent lines and assigning canonical targets.

Given the cannibalization report for {domain} showing URLs competing for the same keywords, analyze the search intent of each competing page. For each conflict, recommend either: (a) a canonical consolidation target, (b) an intent-differentiated split into separate pages, or (c) a redirect. Provide implementation directives and expected ranking outcome for each decision...
rankingcannibalizationintent
GEO v1.0

LLM Source Recency Drift Audit

Tracks how LLM citation preferences for {topic} shift as content publication dates change over time.

For {topic}, compare which sources are cited by Perplexity (with real-time search) versus ChatGPT (knowledge cutoff) for the same query set {query_list}. Identify sources that drop out in recency-sensitive contexts and model what content freshness cadence {domain} must maintain to stay citation-eligible...
georecencycitations
Ranking v1.0

Local Pack Visibility Planner

Diagnoses why {business} is absent from the local pack for {target_queries} and prescribes fixes.

Analyze local pack results for {target_queries} in {location}. Compare the top 3 local pack winners against {business} across review count and recency, GBP category accuracy, citation consistency, proximity signals, and on-page local relevance. Produce a gap-scored action plan ranked by impact on local pack inclusion...
rankinglocal-packlocal-seo
Audit v1.0

Log File Bot Pattern Classifier

Classifies Googlebot and other crawler patterns from raw server log data to surface crawl inefficiencies.

Given the server log excerpt below for {domain}, identify all Googlebot, Bingbot, and GPTBot user agents, calculate crawl frequency per directory, and flag directories consuming disproportionate crawl budget relative to their indexed page count...
auditlog-filecrawl-budget
GEO v1.0

Multi-LLM Source Preference Map

Maps which domains each major LLM preferentially cites for {topic} and surfaces {domain}'s gap.

Submit identical queries about {topic} to ChatGPT, Claude, Perplexity, and Gemini. Record every cited or paraphrased source per model. Build a source preference matrix showing which domains appear in 1, 2, 3, or all 4 models, and identify the content and authority signals that predict multi-model citation...
geomulti-llmcitations
Ranking v1.0

People Also Ask Intent Tree

Builds a full PAA intent tree for {seed_keyword} to surface content and FAQ targeting opportunities.

Starting with {seed_keyword}, expand all available People Also Ask questions through 3 levels of recursion. Organize the results into an intent tree grouped by sub-topic. For each branch, identify whether {domain} has existing content, the estimated PAA impression opportunity, and the optimal answer format (paragraph, list, table)...
rankingpaaintent
Content v1.0

Programmatic SEO Template Brief

Designs a scalable programmatic content template for {page_type} pages with quality guardrails.

Design a programmatic content template for {page_type} pages on {domain} targeting {keyword_pattern}. Define the dynamic content slots, required static content blocks for uniqueness, entity variables, internal link logic, and schema type. Include quality thresholds (minimum word count, required entities, disallowed thin patterns) to prevent mass page quality issues...
contentprogrammatictemplate
GEO v1.0

AEO Question Coverage Gap Planner

Identifies unanswered questions in your content that AI engines are pulling from competitors.

Compare the question set {question_list} for topic {topic} against the existing content on {site_url}. For each question, determine whether your site provides a direct, citable answer. Where gaps exist, note which competitor or source LLMs currently cite, and produce a prioritised AEO content plan with recommended answer formats...
geoaeoquestion-coverage
Ranking v1.0

Branded Query Cannibalization Audit

Detects internal pages competing against each other for the same branded search queries.

Analyse the keyword ranking data {rank_data} for {your_domain} and identify all branded queries {branded_query_list} where more than one internal URL appears in the top 20. For each cannibalization pair, assess which URL should be the canonical target, recommend consolidation or canonicalisation actions, and estimate the ranking uplift from resolution...
rankingcannibalizationbranded
Content v1.0

Content Outline Competitor Authority Signals

Builds a content outline enriched with authority signals extracted from top-ranking competitor pages.

Analyse the top 5 ranking pages for {target_keyword}. Extract: heading structure (H1-H3), average word count, external citations used, expert quotes or data sources, and schema types deployed. Use these authority signals to produce a detailed content outline for {site_url} that matches or exceeds the topical depth of the current top-ranking page...
contentoutlineauthority
Content v1.0

Content Refresh Traffic Gap Brief

Identifies content pages losing traffic and prescribes targeted refresh actions to recover rankings.

Using the GSC performance export {gsc_export} for {site_url} covering {date_range}, identify all pages with a ≥20% year-over-year click decline. For each page, diagnose the likely cause (SERP feature displacement, intent shift, freshness decay, new competitor), and produce a specific refresh brief covering: sections to update, new entities to add, and format changes...
contentrefreshtraffic
Audit v1.0

Core Web Vitals CrUX Segment Reviewer

Breaks down CrUX field data by device and connection type to isolate underperforming segments.

Using the CrUX API data {crux_json} for {site_url}, segment LCP, INP, and CLS scores by device type (mobile/desktop) and effective connection type. Identify which segments fail Core Web Vitals thresholds, quantify the share of sessions affected, and recommend the highest-impact fix per failing segment...
auditcore-web-vitalscrux
GEO v1.0

Entity Prominence Authority Mapper

Maps the topical contexts where your brand entity carries the most and least LLM authority.

Using the entity mention data {mention_data} for {brand_name} across LLM responses for topic set {topic_set}, calculate entity prominence score per sub-topic (frequency of citation × sentiment × ranking position in answer). Identify the five strongest and five weakest prominence areas, and recommend content investments for the weakest zones...
geoentityauthority
Content v1.0

FAQ Intent Schema Planner

Generates intent-mapped FAQ sections with ready-to-use FAQPage schema for a target page.

For the target page {page_url} optimised for {primary_keyword}, generate 8 FAQ questions that cover informational, commercial, and comparison intents surfaced from PAA boxes and related searches. For each question provide: a concise 40-60 word answer, the intent type, and the complete FAQPage JSON-LD block...
contentfaqschema
Ranking v1.0

Featured Snippet Intent Format Matcher

Matches each target query to the snippet format Google favours and prescribes content edits.

For the keyword list {keyword_list}, analyse current featured snippet formats in Google SERPs (paragraph, list, table, video). For each query where {site_url} is not the snippet source, document: current snippet owner, format type, approximate word count, and a specific content edit to {target_url} to compete for that format...
rankingfeatured-snippetsserp
GEO v1.0

Generative SERP Source Preference Brief

Models which content formats and domains Google's generative answers prefer for a topic cluster.

Analyse the generative SERP responses collected for query cluster {cluster_name} and document: preferred source domain types (publisher, brand, wiki, forum), average word count of cited passages, schema types present on cited pages, and content freshness. Produce a source preference model and content specification to match it...
geogenerative-serpsource-authority
Ranking v1.0

Local Pack Visibility Gap Report

Compares local pack rankings across geo-grids to find coverage gaps for a business location.

Using the local rank tracking data {rank_data} for {business_name} in {location}, map ranking positions across a {grid_size} geo-grid. Identify grid cells where the business falls outside the top 3, compare against top-ranking competitors in those cells, and recommend GBP, citation, and content actions to close each gap...
rankinglocal-packgeo-grid
Audit v1.0

Log File Crawl Frequency Audit

Analyses server log data to surface Googlebot crawl frequency anomalies by URL segment.

Using the server log file excerpt {log_data}, segment all Googlebot requests by URL directory, calculate crawl frequency per segment over the period {date_range}, flag segments that are over-crawled or under-crawled relative to their traffic value, and recommend crawl budget adjustments...
auditlog-filecrawl-budget
Technical v1.0

Prerendering Eligibility Config Planner

Evaluates which page types qualify for prerendering and generates the Speculation Rules API config.

For the JavaScript-rendered site {site_url}, evaluate each page template {template_list} for prerendering eligibility: no side-effects on load, stable URL, no authentication gate, and compatible with the Speculation Rules API. Output a Speculation Rules JSON config targeting eligible pages, and a list of ineligible pages with the disqualifying reason...
technicalprerenderingrendering
Technical v1.0

Robots.txt Crawl Segment Optimizer

Rewrites robots.txt directives to protect crawl budget while keeping revenue-critical pages crawlable.

Review the current robots.txt {robots_txt} for {site_url} alongside the crawl log segment data {crawl_log_data}. Identify URL patterns consuming crawl budget with no indexing value (faceted params, session IDs, internal search). Produce a revised robots.txt with disallow rules, crawl-delay recommendations, and a comment explaining each directive...
technicalrobots-txtcrawl-budget
Audit v1.0

Security Header SEO Risk Audit

Reviews HTTP response headers for security misconfigurations that could harm crawling or ranking.

Analyse the HTTP response headers {headers_dump} for {site_url}. Check for misconfigured Content-Security-Policy, X-Frame-Options, Strict-Transport-Security, and Referrer-Policy values that could block Googlebot, strip referral data, or flag the site as insecure. Output a risk table with: header, current value, SEO risk, and recommended value...
auditsecurity-headerstechnical
Content v1.0

Topic Cluster Hub Spoke Brief

Generates a full hub-and-spoke content plan for a pillar topic with internal linking architecture.

For the pillar topic {pillar_topic} and domain {site_url}, produce a hub-and-spoke content plan. Define the hub page scope, list 8-12 spoke topics with target keyword, search intent, recommended content format, estimated word count, and proposed internal link anchor text from the hub. Include a visualisable hierarchy...
contenttopic-clustersinternal-links
Ranking v1.0

Video SERP Structured Data Planner

Identifies video content lacking VideoObject schema and prescribes markup to unlock video SERP features.

Review the video inventory {video_list} hosted on or embedded within {site_url}. For each video, check for VideoObject schema implementation, verify required properties (name, description, thumbnailUrl, uploadDate, duration), and flag gaps. Produce a JSON-LD template for each video type and a priority order based on search volume for {target_queries}...
rankingvideo-serpstructured-data
GEO v1.0

Brand Mention Sentiment Signal Audit

Analyzes brand mentions across web sources to detect sentiment patterns that may influence LLM brand perception.

Analyze the following brand mention dataset for {brand_name}: {mention_data}. Classify each mention by: (1) sentiment (positive/neutral/negative), (2) source authority tier, (3) topical context, and (4) entity co-occurrence. Identify patterns that may negatively influence LLM brand perception and recommend a PR/content strategy to shift sentiment signals...
brand-mentionsgeosentiment
Ranking v1.0

Branded Query Impression Share Gap

Identifies branded query variants where impression share is low, indicating SERP ownership gaps for your brand.

Using GSC data for {site_url}, extract all queries containing '{brand_name}' variants. Identify branded query clusters with: (1) CTR below 50%, (2) average position below 3, (3) impression volume above threshold {impression_threshold}. For each gap cluster, diagnose likely causes (competitor ads, knowledge panel gaps, SERP feature displacement) and recommend fixes...
brandedrankingimpression-share
GEO v1.0

ChatGPT Entity Citation Readiness Audit

Evaluates whether your brand entity has sufficient web signals for ChatGPT to confidently cite it in answers.

Assess the citation readiness of {brand_name} for ChatGPT Browse responses on the topic of {topic}. Evaluate: (1) Wikipedia/Wikidata entity presence, (2) third-party authoritative mentions, (3) structured data entity disambiguation, (4) consistent NAP/brand signals, and (5) topic-to-brand co-occurrence strength. Score overall readiness (0-100) and provide a prioritized improvement plan...
chatgptgeoentity
Ranking v1.0

Competitor Featured Snippet Gap Audit

Identifies featured snippets owned by competitors for queries where you rank on page one but don't hold the snippet.

For the following list of queries where {site_url} ranks positions 2-10: {query_list}, identify which queries have a featured snippet owned by a competitor. For each snippet gap, record: snippet owner, snippet format (paragraph/list/table), current snippet content, and your page's closest matching passage. Produce a prioritized rewrite brief to displace each snippet...
featured-snippetrankingcompetitor
Content v1.0

Content Brief Intent Entity Map

Builds a content brief enriched with SERP intent analysis and entity coverage requirements for a target keyword.

Create a comprehensive content brief for the keyword '{target_keyword}'. Include: (1) dominant SERP intent classification with evidence, (2) required entities and concepts based on top-10 competitor analysis, (3) recommended content format and word count, (4) primary and secondary H2/H3 structure, (5) internal linking targets on {site_url}, and (6) E-E-A-T requirements...
content-briefcontententity
Content v1.0

Content Refresh Decay Triage Plan

Triages a content inventory for decay signals and outputs a prioritized refresh schedule based on traffic loss.

Analyze the following content performance data for {site_url} (last 12 months vs prior 12 months): {performance_data}. Identify pages with: (1) >20% YoY organic traffic decline, (2) declining CTR without position changes, (3) increasing bounce rate. For each decayed page, classify refresh type needed: update statistics, restructure for intent, expand depth, or consolidate. Output a priority-ranked refresh queue...
content-decaycontentrefresh
GEO v1.0

GEO Entity Prominence Content Brief

Builds a content brief that maximizes entity prominence and co-occurrence signals for generative AI citation.

Create a GEO-optimized content brief for the topic '{topic}' targeting citation in AI-generated answers. Include: (1) primary and secondary entities to feature prominently, (2) co-occurrence phrases that LLMs associate with topical authority, (3) recommended passage structures for snippet extraction, (4) authoritative sources to reference or align with, and (5) schema markup recommendations...
geoentitycontent-brief
Audit v1.0

Internal Link Depth Distribution Sweep

Evaluates click depth distribution of key pages to surface pages buried too deep for effective crawling and ranking.

Using the following crawl depth report for {site_url}, analyze the distribution of strategic pages (defined as pages in {priority_url_list}) by click depth from the homepage. Flag any priority pages beyond depth 3, identify the shortest viable linking path, and recommend structural changes to reduce depth. Output a sorted table by depth...
internal-linkscrawlaudit
Ranking v1.0

Keyword Cannibalization Intent Fix Plan

Resolves keyword cannibalization by mapping competing pages to intent variants and recommending consolidation or differentiation.

Given the following cannibalization report for {site_url} (keyword: '{keyword}', competing URLs: {url_list}), classify each URL by its primary intent variant. Determine whether the resolution strategy should be: (1) canonical consolidation, (2) content differentiation, (3) 301 redirect merge, or (4) noindex. Provide a URL-by-URL action plan with implementation steps...
cannibalizationrankingintent
GEO v1.0

LLM Source Preference Content Model

Models the content attributes of LLM-preferred sources to reverse-engineer citation selection criteria.

Collect the top 20 sources most frequently cited by {llm_model} for queries in the {industry} vertical. Analyze each source for: average word count, heading structure, citation density, publication recency, author E-E-A-T signals, and schema usage. Build a content attribute model that describes the ideal citation-ready page for this LLM. Output as a scoring rubric...
llmgeosource-authority
Audit v1.0

Log File Bot Crawl Frequency Analyzer

Parses server log data to surface Googlebot crawl frequency patterns and wasted crawl budget signals.

Analyze the following server log extract for {site_url} (date range: {date_range}). Identify: (1) Googlebot crawl frequency by URL segment, (2) URLs receiving excessive crawls with low SEO value, (3) high-value URLs under-crawled, and (4) any unusual bot spikes. Output findings in a structured table...
log-filecrawl-budgetaudit
GEO v1.0

Multi-LLM Citation Variance Tracker

Compares citation patterns across ChatGPT, Claude, and Perplexity for the same queries to detect LLM-specific gaps.

For the following {n} queries related to {topic}, test responses in ChatGPT (GPT-4o), Claude (Sonnet), and Perplexity. Record which sources each LLM cites. Identify: (1) sources cited by all three, (2) sources exclusive to one LLM, (3) where {your_domain} appears or is absent, and (4) content patterns of consistently cited sources. Produce a variance matrix and gap brief...
multi-llmcitationsgeo
GEO v1.0

Perplexity Citation Competitor Gap Map

Maps which competitor domains Perplexity cites for target queries and identifies content gaps blocking your citations.

For each query in {query_list}, record which domains Perplexity.ai cites in its answers. Compare cited domains against {your_domain}. For queries where {your_domain} is not cited but competitors are, analyze the cited content to identify: format, depth, entity coverage, and structural differences. Output a gap table with actionable content recommendations...
perplexitygeocitations
Technical v1.0

Prerender Eligibility Config Check

Evaluates whether a JavaScript-heavy site's pages qualify for prerendering and specifies the implementation config.

Evaluate the prerendering eligibility of {site_url} built with {js_framework}. Check: (1) Speculation Rules API support in the current setup, (2) pages suitable for prerender vs prefetch based on navigation patterns, (3) server resource impact of prerendering at scale, (4) compatibility with current auth and personalization logic. Output a prerender configuration spec with Speculation Rules JSON and deployment notes...
prerenderingtechnicalrendering
Audit v1.0

Redirect Loop Chain Diagnosis

Traces redirect chains and loops across a URL set to identify PageRank dilution and crawl inefficiency.

Analyze the following redirect map for {site_url}: {redirect_data}. Identify all redirect chains longer than 2 hops, any redirect loops, and 302s that should be 301s. For each issue, output: chain sequence, chain length, redirect types, estimated PageRank dilution risk (High/Med/Low), and recommended consolidation action...
redirectsauditcrawl
Ranking v1.0

SERP Intent Mismatch Scanner

Identifies pages ranking for keywords whose dominant SERP intent doesn't match the page's content format.

Analyze the following keyword-to-landing-page mapping for {site_url}: {keyword_page_data}. For each keyword, classify the dominant SERP intent (informational, commercial, navigational, transactional) by analyzing the top 5 ranking URLs. Flag any mismatches where the landing page format contradicts the dominant intent. Output a mismatch table with recommended content format pivots...
serp-intentrankingcontent-format
Ranking v1.0

SERP Volatility Cause Tracer

Diagnoses the likely causes of sudden SERP ranking volatility by correlating position changes with external signals.

Analyze the following ranking volatility data for {site_url} between {date_start} and {date_end}: {ranking_data}. Correlate position changes with: known Google algorithm updates, competitor content changes, backlink fluctuations, and CrUX metric changes. For each volatile keyword cluster, identify the most probable cause and recommend a stabilization action...
serp-volatilityrankingdiagnosis
Content v1.0

Topic Cluster Hub-Spoke Content Plan

Designs a hub-and-spoke content cluster architecture with pillar and supporting page specifications.

Design a hub-and-spoke content cluster for the topic '{core_topic}' for {site_url}. Define: (1) pillar page scope, target keyword, and word count, (2) 8-12 supporting spoke pages with individual target keywords, content types, and word counts, (3) internal linking architecture between hub and spokes, (4) content differentiation strategy to avoid cannibalization. Output as a cluster blueprint...
topic-clustercontentarchitecture
GEO v1.0

AEO Passage Citation Readiness

Scores individual content passages on {page_url} for answer engine citation readiness.

Extract all H2/H3 sections and their lead paragraphs from {page_url}. For each passage, score it on: answer completeness (does it fully answer an implied question?), passage self-sufficiency (is it understandable without surrounding context?), entity density, and structural clarity. Output a scored table and rewrite the bottom 5 passages to improve citation readiness...
geoaeopassage-optimization
GEO v1.0

ChatGPT Entity Citation Gap Audit

Audits how ChatGPT describes {brand} and identifies entity signal gaps suppressing accurate citation.

Ask ChatGPT (GPT-4o) the following brand-relevant queries about {brand}: {query_list}. For each response, record whether {brand} is mentioned, the context of mention, any factual inaccuracies, and missing entity attributes. Cross-reference against {brand}'s Wikipedia, Wikidata, and official site to identify signal gaps and produce an entity enrichment plan...
geochatgptentity
Technical v1.0

Cloudflare Worker SEO Redirect

Writes a Cloudflare Worker script to handle {redirect_scenario} edge redirects without origin server load.

Write a production-ready Cloudflare Worker script that handles the following redirect scenario for {domain}: {redirect_scenario}. The script must: match the specified URL patterns using regex, return a 301 response with the correct Location header, preserve query strings where specified, exclude Googlebot from redirect loops, and include console.log statements for debugging. Add inline comments explaining each logical block...
technicaledge-seocloudflare
Ranking v1.0

Competitor Rank Gap Opportunity

Finds high-value keywords where competitors rank top 10 but {domain} ranks outside the top 30.

Given the keyword ranking export for {domain} and competitors {competitor_list}: {rankings_csv}, identify all keywords where at least two competitors rank in positions 1–10 and {domain} ranks below position 30 or is absent. Filter for keywords with estimated monthly search volume above {min_volume}, classify by intent, and produce a prioritized opportunity brief with content and link gap analysis for each...
rankingcompetitor-gapkeyword
Audit v1.0

Crawl Budget Template Audit

Reviews crawl budget allocation by page template and flags low-value templates consuming disproportionate crawl.

Given the crawl log summary for {domain} showing Googlebot hits per URL template type: {template_summary}, identify templates consuming more than 15% of total crawl budget with below-average indexation rates, and produce directives (robots.txt disallow, noindex, canonical, internal link reduction) to reclaim budget for high-priority templates...
auditcrawl-budgettechnical
Content v1.0

FAQ Entity Schema Content Builder

Generates FAQ content blocks with embedded FAQ schema for '{topic}' targeting PAA and rich results.

Generate 10 FAQ pairs for the topic '{topic}' targeting {domain}'s audience. Each answer must be 40–60 words, written to be self-contained, entity-rich, and structured to match People Also Ask formats. Then produce the complete FAQPage JSON-LD schema block for all 10 Q&A pairs, ready for insertion into the {page_url} <head>...
contentfaqschema
Ranking v1.0

Local Pack Signal Gap Brief

Benchmarks {business_name}'s local pack signals against top-ranked competitors for {target_keyword}.

For the query '{target_keyword}' in {location}, retrieve the top 3 local pack results and audit each against {business_name} across: GBP completeness, review count and rating, citation consistency (NAP), category match, website SEO signals, and proximity. Produce a prioritized signal gap table with specific actions for {business_name} to close the pack ranking gap...
rankinglocal-seolocal-pack
GEO v1.0

Multi-LLM Coverage Gap Tester

Tests {brand} mention consistency across GPT-4o, Claude 3, and Perplexity for a target query set.

Submit the following queries: {query_list} to GPT-4o, Claude 3 Opus, and Perplexity. For each query, record whether {brand} is mentioned, the sentiment, and the position in the response. Produce a coverage matrix and identify the LLM(s) with the largest mention gaps, then recommend content and authority actions to improve coverage on the lagging LLMs...
geomulti-llmbrand-mention
Ranking v1.0

News SERP Freshness Signal Brief

Produces a freshness signal strategy for {domain} to improve visibility in News and Top Stories SERPs.

Audit {domain}'s current Top Stories SERP appearances for topic '{topic}' using: {gsc_data}. Identify the publish-to-index latency, article schema implementation gaps, Google News inclusion status, internal link patterns for new articles, and AMP status. Compare against Top Stories competitors and produce a freshness signal improvement plan with estimated inclusion probability impact per action...
rankingnews-serpfreshness
Ranking v1.0

PAA Intent Expansion Planner

Mines People Also Ask questions for {seed_query} and maps them to content and ranking opportunities.

Expand the People Also Ask tree for the seed query '{seed_query}' to at least 3 levels deep. Classify each question by intent type (informational, navigational, commercial, transactional), map each to the closest existing page on {domain} or flag as a content gap, and prioritize the top 10 questions by estimated traffic and ranking difficulty for immediate targeting...
rankingpaaintent
Ranking v1.0

SERP Volatility Root Cause Brief

Diagnoses root causes of ranking volatility for {target_keyword} using SERP history and content signals.

Analyze the ranking history for '{target_keyword}' on {domain} over the past 90 days: {rank_history_csv}. Cross-reference ranking fluctuations against: algorithm update dates, competitor content changes, SERP feature appearances, and {domain}'s own content/technical changes. Produce a volatility cause diagnosis with confidence scores and stabilization recommendations...
rankingvolatilityalgorithm
Technical v1.0

Sitemap Split Priority Architecture

Designs an optimized XML sitemap index structure for {domain} with segmentation by content type and priority.

Given {domain}'s URL inventory by content type: {url_inventory_csv}, design a sitemap index architecture that: segments URLs into child sitemaps by content type (product, category, article, landing page), excludes noindex and canonicalized-away URLs, sets lastmod values using actual modification dates, and stays within the 50,000 URL / 50MB per sitemap limits. Output the sitemap index XML and one example child sitemap XML with accurate lastmod format...
technicalsitemapcrawl
Content v1.0

Title Meta Batch Rewrite Optimizer

Rewrites underperforming title tags and meta descriptions for {page_list} to maximize CTR.

Given the following pages on {domain} with current titles, meta descriptions, target keywords, and GSC CTR data: {page_data_csv}, rewrite each title tag (50–60 chars) and meta description (145–160 chars) to: front-load the primary keyword, add a compelling differentiator or number, match SERP intent, and include a call-to-action in the meta description. Output in a table with before/after comparisons...
contentmeta-tagsctr
Content v1.0

Topic Cluster Content Gap Map

Maps missing content pieces in {domain}'s topic cluster for '{pillar_topic}' and prioritizes creation.

Given {domain}'s existing content inventory for the pillar topic '{pillar_topic}': {content_inventory_csv}, and the top 50 keywords in this cluster: {keyword_list}, identify all sub-topics and intent variants without a dedicated page on {domain}. Score each gap by search volume, funnel stage, and internal link potential, then output a prioritized content creation roadmap...
contenttopic-clustergap-analysis
GEO v1.0

AEO Topical Cluster Depth Scorer

Scores a site's topical cluster depth against AEO requirements for answer engine inclusion.

For the topical cluster {cluster} on {brand_domain}, evaluate the depth and breadth of coverage against the subtopics required for answer engine optimization. Score each subtopic on coverage completeness, entity richness, and answer format quality, then output a ranked gap-filling content plan...
geoaeotopical-authority
GEO v1.0

AI Overview Entity Depth Brief

Builds a brief to deepen entity coverage on pages competing for AI Overview inclusion.

For the target query '{query}', retrieve the current AI Overview response and identify all named entities, concepts, and supporting facts cited. Compare these against the content on {url} and output a prioritized entity enrichment brief with specific additions needed to improve AI Overview eligibility...
geoai-overviewentity
Audit v1.0

Broken Link SEO Impact Scorer

Scores broken internal and external links by their estimated PageRank and traffic loss.

Given the following broken link report (4xx responses) for {site_url}, score each broken link by estimated link equity lost (using linking page authority and inbound link count), traffic impact from GSC, and fix priority, then output a ranked remediation queue...
auditbroken-linkslink-equity
Technical v1.0

Cloudflare Worker SEO Edge Spec

Writes a Cloudflare Worker script to handle SEO-critical redirect and header rules at the edge.

Write a Cloudflare Worker script for {site_url} that: (1) implements trailing slash redirect normalization, (2) injects canonical headers for parameterized URLs matching the pattern {url_pattern}, (3) adds security headers (HSTS, X-Frame-Options, CSP) without removing existing headers, and (4) logs redirect events to a KV store for audit...
technicaledge-seocloudflare
Content v1.0

Content Brief Intent Entity Builder

Generates a full content brief with intent mapping, entity requirements, and SERP alignment.

Create a comprehensive content brief for the primary keyword '{keyword}'. Include: dominant SERP intent, required entities and their relationships, recommended content format, target word count, H2/H3 structure, semantic keywords to include, competing pages to outperform, and internal link recommendations for {site_url}...
contentbriefentity
Content v1.0

Content Gap SERP Coverage Finder

Finds content gaps by comparing SERP results to existing site coverage for a topic set.

For the topic set {topics}, analyze the top 10 SERP results for each topic and extract all subtopics, questions, and entities covered by ranking pages. Cross-reference against the existing content inventory for {site_url} and output a gap matrix identifying missing subtopics with recommended page creation or update actions...
contentgap-analysisserp
Content v1.0

Content Outline Hub-Spoke Builder

Structures a hub page outline and matching spoke page outlines for a topic cluster.

For the topic cluster centered on '{hub_topic}', generate a full outline for the hub page and individual outlines for {n} spoke pages. Each outline should include H1, H2s, H3s, key entities, recommended word count, and internal linking directives connecting spokes back to the hub on {site_url}...
contentoutlinetopic-cluster
Content v1.0

Content Refresh Traffic Decay Prioritizer

Ranks content refresh candidates by traffic decay rate, competition, and refresh ROI.

Analyze the following GSC and Analytics data for {site_url} over the past 12 months. Identify pages with a sustained decline in impressions or clicks (>20% YoY), score each by traffic decay severity, current ranking position, and content freshness potential, then output a prioritized refresh queue with specific update recommendations per page...
contentrefreshdecay
Audit v1.0

Duplicate Content Parameter Source Audit

Identifies URL parameter patterns generating duplicate content and prescribes canonical or noindex fixes.

Analyze the following list of URLs and their content fingerprints for {site_url}. Identify all URL parameter variations (e.g., sort, filter, session IDs) that are generating near-duplicate or identical content, and output a parameter handling strategy using canonicals, noindex, or robots.txt for each pattern...
auditduplicate-contentparameters
Content v1.0

E-E-A-T Author Bio Signal Builder

Audits and rewrites author bios to maximize E-E-A-T signals for a given topic area.

Review the following author bio for {author_name} who writes about {topic}. Identify missing E-E-A-T signals (credentials, first-hand experience markers, publication history, industry recognition). Rewrite the bio to explicitly surface these signals, and output additional structured data markup (Person schema) to support the author's expertise claims...
contente-e-a-tauthor
Content v1.0

FAQ Schema Intent Block Drafter

Drafts FAQ content blocks with matching FAQPage schema targeting specific query intents.

For the page targeting '{primary_keyword}' on {url}, generate a set of 8–12 FAQ questions and answers that address informational, commercial, and comparison intent sub-queries. Format the output as both human-readable HTML content and the corresponding FAQPage JSON-LD schema markup...
contentfaqschema
Ranking v1.0

Image SERP Schema Gap Brief

Identifies missing structured data and metadata preventing images from ranking in image SERPs.

Audit the top 20 image SERP results for the query '{query}'. Extract the structured data types, alt text patterns, file naming conventions, and surrounding content signals used by ranking images. Compare against the images on {url} and output a metadata and schema enrichment brief to close the gap...
rankingimage-serpschema
Ranking v1.0

Keyword Cannibalization Intent Split Fixer

Resolves keyword cannibalization by differentiating pages on intent rather than just consolidation.

Given the following cannibalization report where multiple pages on {site_url} compete for '{keyword}', analyze the intent sub-type each page currently serves. Determine whether to consolidate, differentiate by intent, or canonicalize, then output a page-level restructuring plan with title, H1, and content scope changes for each affected URL...
rankingcannibalizationintent
GEO v1.0

LLM Source Recency Gap Fixer

Identifies content freshness gaps preventing LLM inclusion on time-sensitive queries.

For the following time-sensitive query set {queries}, identify which of our pages at {brand_domain} have stale publication or update dates compared to LLM-cited sources. Output a content refresh priority list with specific freshness signals to update (dates, statistics, events) to improve LLM recency scoring...
georecencyllm
Ranking v1.0

Local Pack Signal Gap Fixer

Compares local pack ranking signals between a target business and top-3 pack occupants.

For the local query '{query}' in {location}, retrieve the top 3 Google local pack results and audit their ranking signals (GBP completeness, review volume/sentiment, citation consistency, proximity signals, on-page NAP). Compare each signal to {business_name} and output a prioritized action plan to break into the local pack...
rankinglocal-packlocal-seo
Audit v1.0

Log File Crawl Frequency Segmenter

Segments server log data by bot type and crawl frequency to surface budget waste.

Analyze the following server log file excerpt for {site_url}. Segment all bot requests by user-agent, calculate crawl frequency per URL, identify which low-value URLs are consuming the most crawl budget, and recommend exclusions via robots.txt or noindex...
auditlog-filecrawl-budget
GEO v1.0

Multi-LLM Citation Source Variance

Compares which sources each major LLM cites for identical queries to find coverage gaps.

For the query set {queries}, test each query in ChatGPT, Claude, and Perplexity. Record all cited URLs and domains per LLM, identify sources cited by two or more LLMs but not {brand_domain}, and output a prioritized outreach and content plan to capture cross-LLM citation presence...
geomulti-llmcitation
Technical v1.0

Robots.txt Crawl Efficiency Audit

Audits robots.txt for over-blocking, under-blocking, and crawl efficiency improvements.

Analyze the following robots.txt file for {site_url}. Identify directives that are inadvertently blocking valuable content from crawling, directives missing for low-value URL patterns (parameters, facets, session IDs), and any syntax errors. Output a corrected robots.txt with inline comments explaining each change...
technicalrobots-txtcrawl
Content v1.0

Schema-Rich HowTo Content Spec

Generates a HowTo content draft with embedded HowTo schema markup for rich result eligibility.

Write a step-by-step HowTo guide for '{task}' targeting the keyword '{keyword}'. Structure the content with a clear tool/supply list, numbered steps (each ≤75 words), and estimated time. Output the full article HTML alongside the corresponding HowTo JSON-LD schema markup, ensuring all steps, images, and times are schema-mapped...
contenthowtoschema
Ranking v1.0

SERP Intent Mismatch Page Fixer

Detects pages ranking for queries where intent mismatches the page format, causing rank loss.

For each URL-keyword pair in the following dataset {url_keyword_pairs}, compare the dominant SERP intent for the keyword (informational, transactional, navigational, commercial) against the current page type and content format of the ranking URL. Flag all mismatches and output a content restructuring or intent-redirect plan...
rankingintentserp
Technical v1.0

SSR Hydration SEO Gap Audit

Identifies content visible only post-hydration that Googlebot may miss during SSR indexing.

Compare the server-side rendered HTML and the fully hydrated DOM for {url} using the following Googlebot fetch and browser render outputs. Identify all content elements, links, and structured data that appear only after JavaScript hydration and are therefore invisible to Googlebot at crawl time. Output a pre-rendering or SSR remediation plan...
technicalssrrendering
Technical v1.0

XML Sitemap Index Health Audit

Audits sitemap index files for inclusion errors, non-indexable URLs, and freshness signals.

Audit the XML sitemap index at {sitemap_url} for {site_url}. Check for: URLs that return non-200 status codes, URLs blocked by robots.txt or noindex, missing lastmod dates, incorrect priority/changefreq values, and pages excluded from sitemaps that should be included. Output a corrected sitemap specification and submission plan...
technicalsitemapindexing
GEO v1.0

AI Overview Passage Depth Ranker

Scores how well individual page passages answer queries likely to trigger AI Overviews.

For the following target queries that currently trigger AI Overviews: {query_list}, evaluate each passage from {page_url} for retrieval likelihood. Score each passage on: query relevance (0-10), factual completeness (0-10), passage length fit, and entity coverage. Output a ranked table of passages with scores, the specific text excerpt, and a rewrite recommendation to increase retrieval probability...
geoai-overviewpassage-optimization
Ranking v1.0

Branded Query SERP Gap Defender

Identifies SERP positions for branded queries owned by competitors and builds a reclamation plan.

For brand queries containing {brand_name}, analyze the top 20 SERP results and identify all positions occupied by non-brand-owned content (competitor comparison pages, review sites, news articles, forums). For each non-brand position in the top 10, assess: URL, content type, why it outranks brand-owned content, recommended countermeasure (new brand page, featured snippet capture, schema markup, or link acquisition), and reclamation priority...
rankingbranded-queriesserp-defense
GEO v1.0

ChatGPT Entity Brand Readiness Scorer

Evaluates how well a brand's web presence signals entity readiness for ChatGPT citation selection.

Evaluate the following brand entity signals for {brand_name} across its web presence: {entity_signal_data}. Score the brand's readiness to be cited by ChatGPT across these dimensions: Wikipedia/Wikidata presence, consistent NAP signals, authoritative third-party mentions, structured data entity markup, and topical authority depth. Output a scorecard with dimension scores (0-10), key gaps, and a 30-day improvement roadmap...
geochatgptentity
Ranking v1.0

Competitor Content Rank Gap Harvester

Identifies keywords where competitors rank in positions 1-10 but the target site has no ranking page.

Using the following competitor keyword ranking data for {competitor_domains} vs. {our_domain}: {ranking_data}, identify all keywords where at least one competitor ranks in positions 1-10 and {our_domain} has no page ranking in the top 50. Filter by: search_volume > {min_volume}, keyword difficulty < {max_kd}, and intent types matching {intent_filter}. Output a harvested gap list with: keyword, search_volume, top_ranking_competitor, their_ranking_url, intent_type, recommended_page_type...
rankingcompetitor-gapkeyword-research
Content v1.0

Content Decay Page Refresh Brief

Diagnoses traffic decay root causes for a specific page and produces a targeted refresh brief.

Analyze the following traffic and ranking data for {page_url} over the period {date_range}: {page_performance_data}. Diagnose the primary causes of traffic decay from the following possibilities: content staleness, SERP intent shift, competitor content improvement, featured snippet loss, or algorithm update impact. Produce a refresh brief with specific section-by-section rewrite instructions, new data sources to cite, structural changes needed, and updated internal linking recommendations...
contentcontent-decayrefresh
Audit v1.0

Core Web Vitals CrUX Regression Audit

Compares CrUX field data over time to surface regressions in LCP, INP, and CLS by segment.

You are a Core Web Vitals diagnostic specialist. Given the following CrUX API data snapshots for {site_url} covering the periods {date_range}, identify any metric regressions in LCP, INP, or CLS across device segments (mobile/desktop) and URL groups. For each regression, output: metric, segment, affected_url_pattern, baseline_value, current_value, regression_magnitude, probable_cause, and fix_priority...
auditcore-web-vitalsperformance
Technical v1.0

Edge SEO Meta Tag Injector Spec

Specifies an edge worker script to inject or modify SEO meta tags without CMS deployment cycles.

Write a Cloudflare Worker (or equivalent edge function) script for {site_url} that intercepts HTML responses and dynamically injects or modifies the following SEO meta tags without requiring CMS changes: {meta_tag_rules}. The script must use HTMLRewriter to surgically modify the <head> section, handle URL-pattern-based conditional logic for different page types, preserve existing tags where injection is additive, and log all modifications. Include error handling to pass through the original response if the worker fails...
technicaledge-seometa-tags
Content v1.0

FAQ Block Entity Answer Generator

Generates SEO-optimized FAQ blocks with entity-rich answers and FAQPage schema markup.

Generate a FAQ block for {page_url} targeting the topic {target_topic}. Extract the top 8 questions from PAA data and related searches: {question_data}. For each question, write an answer that: is 40-60 words, begins with a direct answer, includes at least one semantically relevant entity, and is optimized for both featured snippet capture and AI Overview citation. Append a complete FAQPage JSON-LD schema block containing all questions and answers...
contentfaqschema
Ranking v1.0

Featured Snippet Passage Rewriter

Rewrites target page passages into formats most likely to win featured snippet positions.

For the following query {target_query} where {competitor_url} currently holds the featured snippet, analyze the snippet format (paragraph/list/table) and rewrite the corresponding passage from {our_page_url} to outcompete it. The rewrite must: match or exceed the answer completeness, use the optimal format for the query type, begin with a direct answer within the first sentence, and stay within {word_limit} words. Output the rewritten passage and a before/after comparison...
rankingfeatured-snippetrewriting
GEO v1.0

Generative SERP Source Format Mapper

Maps which content formats are most frequently sourced by generative SERP features for a topic set.

For the following set of queries in {industry}: {query_list}, analyze generative SERP feature appearances (AI Overviews, Perplexity answers, ChatGPT responses) and categorize the content formats most frequently sourced: listicles, how-to guides, data studies, expert Q&As, FAQs, comparison pages, etc. Output a format frequency matrix per query intent type with recommendations for {brand_domain} content production...
geogenerative-serpcontent-format
Audit v1.0

JS Render Content Delta Checker

Compares raw HTML vs. rendered DOM to identify content and links invisible to crawlers.

Compare the following raw HTTP response HTML and post-render DOM snapshot for {page_url}. Identify all text content, internal links, structured data, and meta tags present in the rendered DOM but absent from the raw HTML. Also flag any content present in raw HTML that is removed post-render. Output a delta table: element_type, raw_html_present (yes/no), rendered_dom_present (yes/no), seo_impact (high/medium/low), fix_recommendation...
auditjavascriptrendering
Technical v1.0

JSON-LD Organization Schema Generator

Generates a complete Organization JSON-LD schema block with all recommended properties for brand SERP.

Generate a complete Organization schema in JSON-LD format for {brand_name}. Include all recommended Schema.org properties: @type, name, url, logo, sameAs (all social and directory profile URLs), contactPoint (with contactType and telephone), address (PostalAddress), foundingDate, description, and numberOfEmployees. Use the following brand data as input: {brand_data}. Validate the output against Google's Rich Results requirements and flag any missing recommended fields...
technicalschemajson-ld
Ranking v1.0

Local Pack Citation Signal Builder

Audits local citation consistency and builds a fix plan to strengthen local pack ranking signals.

For {business_name} targeting local pack rankings in {target_location}, audit the following citation data across directories: {citation_data}. Identify all NAP inconsistencies (name, address, phone variations), missing high-authority directory listings, and category mismatches. Output a citation fix plan ranked by directory authority with: directory, current_listing_status, nap_issue, correct_nap, fix_action, and estimated_ranking_impact...
rankinglocal-packcitations
GEO v1.0

Multi-LLM Citation Format Tester

Tests how content formatting changes affect citation frequency across multiple LLM platforms.

You are a GEO research analyst. Given the following two content variants for {page_url} — Variant A: {variant_a} and Variant B: {variant_b} — predict which variant is more likely to be cited by ChatGPT, Perplexity, Claude, and Google AI Overviews for the query {target_query}. For each LLM, provide: predicted_citation_variant, confidence (high/medium/low), key_reasons, and recommended format improvements...
geomulti-llmcontent-format
Ranking v1.0

People Also Ask Intent Bridge Builder

Maps PAA question chains to content gaps and builds intent bridges to capture PAA rankings.

Given the following seed query {seed_query}, extract the full PAA expansion tree (up to 3 levels deep). For each PAA question, classify the intent type, map it to an existing or missing page on {site_url}, and recommend: whether to answer on the existing target page, create a new page, or add an FAQ block. Output a PAA intent map with: question, intent_type, existing_page (if any), recommended_action, suggested_answer_format, and estimated_traffic_opportunity...
rankingpaaintent
GEO v1.0

Perplexity Source Competitor Profiler

Maps which competitor domains Perplexity cites most for a topic set and surfaces citation gap patterns.

For the following topic queries in the {industry} space: {query_list}, collect Perplexity AI citation data and identify which competitor domains are cited most frequently. For each topic cluster, output: query, top_cited_domains, citation_frequency, content_format_cited (article/study/FAQ/etc.), why_likely_cited, and actionable gap recommendation for {brand_domain} to compete for citations...
geoperplexitycompetitor-analysis
Technical v1.0

Prerender Eligibility Rules Configurator

Defines prerendering eligibility rules for a site to optimize speculative load and crawler rendering.

Design a prerendering configuration for {site_url} using the Speculation Rules API. Based on the following user navigation pattern data: {navigation_data}, specify: which URL patterns qualify for prerender vs. prefetch, the eagerness setting (immediate/eager/moderate/conservative) per URL type, exclusion rules for authenticated or cart pages, and how to implement the rules as an inline JSON script tag. Also provide a Googlebot-specific prerender compatibility checklist to avoid rendering budget waste...
technicalprerenderingrendering
Content v1.0

Programmatic SEO Page Schema Template

Builds a reusable content and schema template for programmatic page generation at scale.

Design a programmatic content and schema template for {page_type} pages on {site_url} targeting the keyword pattern {keyword_pattern}. The template must include: a dynamic title tag formula, meta description formula, H1 pattern, required content sections with variable placeholders ({variable_name} syntax), minimum content requirements per section, schema markup template (JSON-LD) with dynamic field mappings, and internal link slot specifications. Include quality guardrails to prevent thin content at scale...
contentprogrammatic-seoschema
Technical v1.0

Security Headers SEO Impact Spec

Configures security headers that satisfy crawler requirements without blocking SEO-critical resources.

Audit the following current HTTP security headers for {site_url}: {header_data}. Identify configurations that may harm SEO: CSP directives blocking external scripts or fonts Googlebot needs to render content, X-Frame-Options preventing rich result eligibility, or HSTS misconfiguration. Then produce a corrected header configuration (in both Apache .htaccess and Nginx formats) that achieves strong security posture while explicitly allowing Googlebot rendering and critical third-party resource loading...
technicalsecurity-headersseo
Ranking v1.0

SERP Volatility Cause Root Mapper

Maps ranking volatility patterns to probable algorithm update causes for a target keyword set.

Analyze the following ranking history data for {site_url} across the keyword set {keyword_list} covering the period {date_range}. Cross-reference volatility spikes with known Google algorithm update dates and SERP feature changes. For each volatility event, output: keyword, rank_before, rank_after, date, probable_cause (update name/type), whether competitor gains are content/link/technical-driven, and a stabilization action recommendation...
rankingvolatilityalgorithm
Ranking v1.0

Shopping SERP Feed Schema Optimizer

Audits product schema and merchant feed data to maximize Shopping SERP feature eligibility.

Review the following product page schema and Google Merchant Center feed data for {product_category} products on {site_url}: {product_data}. Identify all schema.org Product markup gaps, Merchant Center feed attribute errors, and rich result eligibility blockers. For each issue, provide: affected_product_url, issue_type, current_value, required_value, fix_implementation_code, and expected_rich_result_eligibility_change...
rankingshopping-serpschema
Content v1.0

Title Tag SERP CTR Batch Rewriter

Rewrites underperforming title tags using CTR psychology and SERP competitive signals.

Rewrite the following underperforming title tags for {site_url}: {title_tag_data}. For each URL, analyze its current average CTR vs. position-based benchmark, the SERP competitor titles, and the target keyword intent. Produce a new title tag that: incorporates a power word or number where appropriate, stays within 55 characters, includes the primary keyword near the front, differentiates from competitor titles, and matches search intent. Output: URL, current_title, current_ctr, new_title, rationale...
contenttitle-tagsctr
Technical v1.0

XML Sitemap Priority Split Architect

Designs a split sitemap index structure that segments URLs by type and crawl priority.

Design a complete XML sitemap architecture for {site_url} with the following URL inventory: {url_inventory}. Create a sitemap index that splits URLs into logical sub-sitemaps by content type (e.g., core-pages, blog-posts, product-pages, images, news). For each sub-sitemap, specify: file naming convention, URL inclusion criteria, lastmod update strategy, changefreq and priority values, and maximum URL count per file. Output the sitemap index XML and template XML for each sub-sitemap type...
technicalsitemapcrawl
GEO v1.0

AI Mode Visibility Content Scorer

Scores existing content pages on their likelihood of appearing in Google AI Mode responses.

Evaluate the following {n} pages from {domain} against Google AI Mode selection criteria: {url_list}. Score each page on entity clarity, passage directness, E-E-A-T signals, and structured data presence. Output a ranked scorecard with per-page improvement actions...
geoai-modescoring
Ranking v1.0

Branded Query Impression Audit

Analyzes branded vs. non-branded query split to assess brand search health and opportunity gaps.

Using this Google Search Console query export for {domain}: {gsc_export}, segment all queries into branded and non-branded. Calculate impression share, CTR, and average position for each segment. Identify which branded query sub-types (product, review, navigation) have the lowest CTR and recommend SERP improvements...
rankingbrandedgsc
GEO v1.0

Claude Citation Pattern Scorer

Analyzes Claude's citation selection patterns for a topic to model source preference criteria.

Submit these {n} queries to Claude: {query_list}. For each response, extract cited URLs, classify each source by domain type (publisher, brand, wiki, gov), and identify the content structure patterns that appear most frequently in cited pages. Provide a scored model of Claude's selection preferences...
geoclaudecitation
Ranking v1.0

Competitor SERP Gap Cluster Map

Maps topic clusters where top competitors rank but the target domain has no presence.

Compare the ranking keyword sets for {domain} and competitors {competitor_list} using this data: {keyword_gap_data}. Identify topic clusters where competitors rank in positions 1–10 but {domain} ranks outside the top 50. Group gaps by cluster theme and estimate traffic opportunity for each...
rankingcompetitorgap-analysis
Content v1.0

Content Brief Intent Alignment

Builds a content brief calibrated to the dominant SERP intent for a target keyword.

Analyze the top 10 SERP results for "{target_keyword}". Classify the dominant intent (informational, navigational, commercial, transactional) and the secondary intent signals. Build a complete content brief for {domain} that aligns format, depth, word count, and heading structure to match winning intent patterns...
contentintentbrief
Content v1.0

Content Decay Traffic Loss Plan

Diagnoses traffic loss on decaying pages and prescribes a prioritized refresh action plan.

Using this GSC performance data for {domain}: {gsc_traffic_data}, identify pages with consistent impression or click decline over the past {time_period}. For each decaying page, diagnose the likely cause (freshness, intent drift, SERP feature displacement, competitor improvement) and prescribe a specific refresh action...
contentcontent-decayrefresh
GEO v1.0

Entity Prominence Content Brief

Builds a content brief designed to increase entity prominence signals recognized by LLMs.

Create a content brief for {target_url} that maximizes entity prominence for {primary_entity} across LLM training and retrieval signals. Include required co-occurring entities, recommended passage structures, citation-worthy claim density targets, and internal linking anchors...
geoentitycontent-brief
Content v1.0

FAQ Intent Content Generator

Generates FAQ blocks with answers calibrated to PAA intent and FAQ schema requirements.

For the topic "{topic}", generate {n} FAQ pairs where each question mirrors a real People Also Ask question. Write answers at {word_count} words each, structured to qualify for FAQ rich results (direct answer first, supporting detail second). Include the complete FAQ schema markup block...
contentfaqschema
GEO v1.0

Generative SERP Topical Gap Finder

Identifies topical subtopics covered in AI-generated answers but absent from a site's content.

Collect AI Overview and AI Mode answers for the query set: {query_set}. Extract every subtopic, entity, and claim that appears in generated answers. Cross-reference against {domain}'s sitemap to identify coverage gaps, and output a prioritized content creation list...
geotopical-authoritygap-analysis
Audit v1.0

Indexing Coverage Drop Audit

Diagnoses sudden drops in indexed page counts using GSC coverage data and crawl comparisons.

Given this Google Search Console coverage report: {gsc_coverage_data} and crawl snapshot comparison between {date_before} and {date_after}, identify which URL segments lost indexing, classify the likely causes (noindex, crawl block, canonicalization), and recommend remediation steps...
auditindexinggsc
Technical v1.0

JS Render Gap Content Detector

Compares raw HTML vs. rendered DOM to detect SEO content invisible to crawlers before JS executes.

For these URLs: {url_list}, compare the raw HTML response and the fully rendered DOM. Identify any SEO-critical elements (headings, body text, internal links, canonical tags, structured data) that are absent from the raw HTML and only present post-JavaScript execution. Output a fix recommendation for each gap...
technicalrenderingjavascript
Ranking v1.0

Knowledge Panel Signal Builder

Identifies missing entity signals needed to trigger or expand a brand's Google Knowledge Panel.

Audit the Knowledge Panel status for {brand_name}. Check Wikipedia presence, Wikidata entity completeness, structured data on {domain}, and consistent NAP data across top directories. For each missing signal, provide the exact step to add it and estimate the panel attribute it would unlock...
rankingknowledge-panelentity
Audit v1.0

Log File Crawl Budget Analysis

Analyzes server log data to surface crawl waste and Googlebot frequency patterns by URL segment.

Using the following server log export: {log_data}, segment Googlebot hits by URL template type, identify which sections consume the most crawl budget relative to their indexing value, and produce a ranked list of crawl waste reduction actions...
auditlog-filecrawl
GEO v1.0

Multi-LLM Source Variance Tester

Tests the same query across multiple LLMs to reveal source selection variance and coverage gaps.

Run the query "{target_query}" in ChatGPT, Claude, Perplexity, and Gemini. Record which sources each LLM cites, identify sources cited by three or more LLMs (consensus sources), flag sources unique to one LLM, and produce a table showing {domain}'s presence across all four platforms...
geomulti-llmcitation
GEO v1.0

Perplexity Citation Authority Model

Models which site authority signals most predict citation selection in Perplexity for a given topic.

For the topic {topic}, collect the top 20 URLs currently cited in Perplexity answers. Analyze their common domain authority signals, content structure patterns, and topical depth characteristics. Produce a weighted model of the citation selection factors and a gap analysis for {domain}...
geoperplexitycitation
Content v1.0

Programmatic Content Audit Planner

Audits programmatic page templates for thin content risk and maps quality improvement actions.

Review this sample set of programmatic pages from {domain}: {url_sample}. Assess each template for thin content risk (word count, unique content ratio, structured data completeness, internal link depth). Score each template on a risk scale and recommend the minimum content additions to meet quality thresholds...
contentprogrammaticthin-content
Technical v1.0

Security Headers CSP SEO Builder

Generates Content Security Policy and security headers that protect SEO without blocking crawlers.

Generate security header directives for {domain} including Content-Security-Policy, X-Robots-Tag, X-Frame-Options, and Strict-Transport-Security. Ensure that the CSP policy does not block Googlebot's access to render-critical JavaScript or CSS, and validate that no directive inadvertently suppresses indexing...
technicalsecurity-headerscsp
GEO v1.0

Source Authority Drift Tracker

Tracks month-over-month shifts in which domains LLMs prefer as sources for a target topic.

For topic {topic}, record the domains cited in LLM answers during {month_1} and {month_2}. Compare both snapshots to identify which domains gained or lost citation frequency, calculate drift scores, and flag whether {domain} improved, declined, or remained absent...
geosource-authoritydrift
Ranking v1.0

Branded Query SERP Feature Planner

Plans actions to own more SERP features for branded query searches.

Analyze the SERP for branded queries related to {brand}: {branded_query_list}. Identify which SERP features appear (knowledge panel, sitelinks, reviews, image pack, video carousel, FAQ, social profiles) and which {brand} currently owns vs. loses to competitors or third parties. Output a feature ownership improvement plan...
rankingbrandedserp-features
GEO v1.0

Citation Pre Publish Signal Checklist

Runs a pre-publication checklist to maximize a new piece of content's LLM citation potential.

Before publishing the article titled '{article_title}' at {site_url}, evaluate it against this GEO citation checklist: original data or statistics present, authoritative external sources cited, entity markup included, author E-E-A-T signals visible, passage-level answers clearly formatted. Return a pass/fail for each item with specific edits needed...
geocitationpre-publish
Content v1.0

Content Brief SERP Intent Optimizer

Generates a content brief precisely aligned to the dominant search intent of a target query.

Analyze the top 10 SERP results for '{target_keyword}' and classify the dominant search intent (informational, navigational, commercial, transactional). Generate a full content brief for {site_url} that matches the dominant intent, including: recommended content format, required headings, target word count, entities to mention, and E-E-A-T signals to include...
contentcontent-briefintent
Content v1.0

Content Decay Traffic Loss Brief

Diagnoses traffic-declining pages and generates a targeted refresh brief to recover lost rankings.

Analyze the traffic and ranking trend data below for the page at {page_url}. Identify the likely decay causes (freshness, SERP feature displacement, competitor content improvement, intent shift). Generate a specific refresh brief including: sections to update, statistics to replace, new entities to add, and structural changes needed...
contentcontent-decayrefresh
Content v1.0

Content Outline Competitor Entity Gap

Builds a content outline by identifying entity and subtopic gaps vs. top-ranking competitor pages.

Compare the content of the top 5 ranking pages for '{target_keyword}' against the draft outline below for {site_url}. Identify entities, subtopics, statistics, and semantic concepts present in competitor content but missing from the outline. Produce an enriched outline that fills all significant gaps...
contentoutlinecompetitor-gap
GEO v1.0

GEO Topical Entity Prominence Brief

Creates a content brief designed to strengthen entity prominence for GEO visibility in a topic space.

Build a GEO-optimized content brief for {brand} targeting the topic '{target_topic}'. Include: required entities to mention, recommended authoritative sources to cite, optimal passage structures for AI extraction, and E-E-A-T signals to embed throughout the piece...
geoentitycontent-brief
Audit v1.0

Log File Bot Crawl Frequency

Parses server log data to surface Googlebot crawl frequency patterns and anomalies.

Given the server log excerpt below for {domain}, calculate Googlebot crawl frequency by URL segment, identify spikes or drop-offs, and flag any segments receiving disproportionate or zero crawl attention...
auditlog-filecrawl
Audit v1.0

Internal Link Depth Map Audit

Scores the internal link equity distribution across site sections to find equity dead-ends.

Using the internal link graph data below for {site_url}, calculate the PageRank distribution estimate per section. Identify sections that receive fewer than {threshold}% of total internal link equity and recommend redistribution tactics...
auditinternal-linksequity
Audit v1.0

Mobile First Rendering Gap Check

Compares desktop vs. mobile-rendered HTML to surface content missing from the mobile DOM.

Compare the desktop-rendered HTML and mobile-rendered HTML below for {page_url}. Identify any content blocks, structured data, or internal links present on desktop but absent or altered on mobile, and flag each as a mobile-first indexing risk...
auditmobile-firstrendering
GEO v1.0

Multi LLM Source Preference Audit

Compares which sources each major LLM favors for a given topic to expose brand visibility gaps.

Run the query '{target_query}' through ChatGPT, Claude, Gemini, and Perplexity. Record all cited or referenced sources per model. Output a matrix showing which domains appear in 1, 2, 3, or all 4 models, and flag where {brand} is absent...
geomulti-llmbrand-visibility
Technical v1.0

Prerender Eligibility Bot Config

Configures prerendering rules that serve static HTML to search bots while preserving dynamic UX.

Design a prerendering configuration for {site_url} using {prerender_service}. Specify: the bot user-agent list that should receive prerendered responses, URL patterns to include and exclude from prerendering, cache TTL per page type, and cache invalidation triggers. Output the complete middleware or CDN rule configuration code...
technicalprerenderingrendering
Technical v1.0

Robots Txt Crawl Budget Optimizer

Reviews and rewrites robots.txt to protect crawl budget by blocking low-value URL patterns.

Analyze the robots.txt file and crawl log data below for {site_url}. Identify URL patterns being crawled that have no indexing value (e.g., filter parameters, session IDs, internal search results, print pages). Generate an optimized robots.txt with Disallow rules for each low-value pattern, and explain the crawl budget impact of each change...
technicalrobots-txtcrawl-budget
Content v1.0

Schema Rich How To Content Builder

Creates HowTo-structured content with embedded JSON-LD for rich result eligibility.

Write a how-to article for {site_url} targeting the query '{target_query}'. Structure the content with a brief intro, then numbered steps each containing a step name, text description (50-100 words), and an optional image placeholder. After the article, output a complete HowTo JSON-LD block mapping to each step...
contenthow-toschema
Technical v1.0

Server Side Rendering SEO Config Spec

Produces an SSR configuration spec ensuring all critical SEO elements render server-side.

Given the current rendering architecture for {site_url} ({framework} framework), produce an SSR configuration spec that ensures the following render server-side: title tags, meta descriptions, canonical tags, hreflang tags, structured data, and H1. Include code snippets for each element and flag any that currently render client-side only...
technicalssrrendering
GEO v1.0

Source Authority LLM Signal Builder

Identifies and builds the off-page authority signals that increase LLM source selection likelihood.

For {brand} competing in the {industry} space, identify the top 10 authority signals (e.g., Wikipedia mentions, industry publication citations, academic references, high-DR backlinks) currently missing or weak. For each, provide a concrete acquisition tactic and estimated impact on LLM source selection...
geoauthorityllm
Ranking v1.0

Video SERP Schema Gap Optimizer

Identifies missing VideoObject schema and metadata gaps blocking video SERP rich results.

Review the video content pages listed below from {site_url}. For each page, audit: VideoObject schema presence, thumbnail URL, duration, upload date, description length, and transcript availability. Flag all missing fields, generate corrected JSON-LD snippets, and prioritize by estimated rich-result impact...
rankingvideo-serpschema
GEO v1.0

AEO Topical Authority Brief

Defines the content depth and breadth needed to establish AEO topical authority in a niche.

For the niche {niche}, map the full topical landscape required for {brand} to be recognized as an authoritative answer source by AI engines. Identify coverage gaps, recommend content types, and prioritize by AEO impact score...
geoaeotopical-authority
GEO v1.0

AI Overview Content Eligibility

Scores a page's content structure for likelihood of being pulled into a Google AI Overview response.

Evaluate the following page content from {url} against known AI Overview inclusion signals: passage clarity, factual density, structured formatting, and E-E-A-T markers. Produce a scored eligibility report with specific copy edits to improve inclusion chances...
geoai-overviewgenerative-serp
Technical v1.0

Cloudflare Worker SEO Ruleset

Writes Cloudflare Worker JavaScript to handle SEO redirects, header injection, and bot routing at the edge.

Write a Cloudflare Worker script for {domain} that: (1) enforces HTTPS and www/non-www canonicalization via 301 redirects, (2) injects canonical and X-Robots-Tag headers based on URL path patterns, and (3) routes known SEO bot traffic to a prerender service at {prerender_url}...
technicaledge-seocloudflare
Ranking v1.0

Competitor Content Rank Gap

Finds keywords where competitors rank in the top 10 but {brand} has no ranking URL at all.

Compare the keyword ranking profiles of {brand} and {competitor_list}. Identify keywords where competitors hold top-10 positions but {brand} has no ranking page. Cluster gaps by topic and commercial value, then recommend new content or optimization targets...
rankingcompetitor-gapkeyword
Content v1.0

Content Brief Intent Depth

Generates a detailed content brief matched to SERP intent, covering headings, questions, and word count.

Create a full content brief for the target keyword {keyword} on {domain}. Include recommended H1 and H2 structure, target word count, semantic terms to include, questions to answer, intent alignment notes, and E-E-A-T signals to incorporate...
contentbriefintent
Ranking v1.0

Featured Snippet Format Brief

Identifies the optimal featured snippet format (paragraph, list, table) for a target keyword set.

For each keyword in {keyword_list}, analyze the current featured snippet format (paragraph, numbered list, bulleted list, or table). Recommend the optimal answer format for {brand}'s content to displace the current snippet holder, with exact copy templates for each...
rankingfeatured-snippetserp
GEO v1.0

Generative SERP Targeting Plan

Builds a content plan designed to appear in AI-generated SERP features for a target topic cluster.

For the topic cluster {topic_cluster}, create a generative SERP targeting plan for {brand}. Identify query formats most likely to trigger AI Overviews or AI Mode responses, map required content attributes, and specify page-level optimizations to improve feature inclusion...
geogenerative-serpcontent-plan
Technical v1.0

INP Interaction Trace Audit

Traces slow INP interactions to their root JavaScript event handlers and recommends optimization fixes.

Using the INP trace data below from {url}, identify the specific user interaction events (click, keypress, tap) with the highest input delay and processing time. Map each slow event to its responsible JavaScript handler and recommend code-level optimizations to bring INP under 200ms...
technicalinpcore-web-vitals
Content v1.0

Internal Link Anchor Gap Plan

Identifies target pages lacking keyword-rich internal link anchors and prescribes specific anchor text additions.

Review the internal link profile for {target_url} on {domain}. List all current internal anchor texts pointing to this page, identify missing exact-match and partial-match keyword anchors, and recommend specific source pages, placement locations, and anchor text copy to add...
contentinternal-linksanchor-text
Technical v1.0

JSON-LD Organization Builder

Generates a complete Organization JSON-LD schema block with all recommended properties for brand entity signals.

Generate a complete Organization schema in JSON-LD format for {brand}. Include name, url, logo, contactPoint, sameAs (all social and directory profiles), foundingDate, numberOfEmployees, and address. Validate against Schema.org and flag any missing recommended properties...
technicaljson-ldschema
Ranking v1.0

Knowledge Panel Gap Audit

Identifies missing or incorrect Knowledge Panel attributes for a brand entity and maps correction paths.

Review the Google Knowledge Panel for {brand}. List all currently displayed attributes, identify missing high-value attributes (founding date, CEO, social profiles, etc.), and recommend specific structured data, Wikipedia, and Wikidata edits to populate each gap...
rankingknowledge-panelentity
GEO v1.0

LLM Source Authority Calibration

Models which authority signals most predict a domain being cited by LLMs in a given topic area.

Analyze the top 20 domains cited by {llm_name} for queries related to {topic}. Identify the common authority signals (DR, topical relevance, Wikipedia links, schema, recency) and build a weighted model predicting citation likelihood for new domains...
geosource-authorityllm
Ranking v1.0

Local Pack Signal Audit

Audits GBP signals, citation consistency, and review velocity affecting local pack ranking position.

Audit the local pack ranking factors for {business_name} in {location} for the keyword {keyword}. Evaluate GBP completeness, NAP citation consistency, review count and recency, and proximity signals. Produce a ranked list of improvements to gain pack position...
rankinglocal-packgbp
GEO v1.0

Multi-LLM Citation Coverage Test

Tests {brand} citation presence across ChatGPT, Claude, Perplexity, and Gemini for a target query set.

For each query in {query_list}, test ChatGPT, Claude, Perplexity, and Gemini and record whether {brand} is cited, its position, and the surrounding context. Produce a cross-LLM coverage matrix with gap commentary...
geomulti-llmcitation
Technical v1.0

Prerender Service Config Spec

Specifies configuration rules for a prerender service to correctly serve static HTML to search engine bots.

Write a prerender service configuration spec for {domain} built on {framework}. Define the bot user-agent whitelist, URL inclusion/exclusion rules, cache TTL per page template, and fallback behavior. Include validation steps to confirm Googlebot receives correct prerendered output...
technicalprerenderrendering
Content v1.0

Programmatic SEO Seed Template

Designs a scalable content template and variable schema for programmatic page generation at scale.

Design a programmatic SEO content template for {page_type} pages targeting the pattern {keyword_pattern} on {domain}. Specify all dynamic variables, static content blocks, schema type, internal linking logic, and uniqueness safeguards to prevent thin-content penalties...
contentprogrammatictemplate
Audit v1.0

Schema Audit Coverage Types

Audits a site's schema markup implementation to identify missing types and misconfigured properties.

Review the schema markup currently implemented on {domain}. List all detected schema types, flag missing required properties, identify incorrect nesting, and recommend additional schema types for eligible page templates...
auditschemastructured-data
Content v1.0

Schema-Rich How-To Brief

Creates a structured how-to content draft with embedded HowTo schema markup for rich result eligibility.

Write a step-by-step how-to guide on {how_to_topic} formatted for Google HowTo rich results. Include a brief introduction, 5-8 numbered steps each with a clear action verb, and output the complete HowTo JSON-LD schema with name, step, image, and supply properties populated...
contenthow-toschema
Technical v1.0

SSR Hydration SEO Audit

Checks for hydration mismatches in server-side rendered pages that can cause Googlebot to miss key content.

Perform an SSR hydration audit for {domain}. Compare the raw HTML served by the server against the post-hydration DOM for {url_list}. Identify content, links, or metadata that appear only after JavaScript hydration and assess crawl risk for each discrepancy...
technicalssrrendering
Ranking v1.0

Competitor Gap Rank Map

Maps keywords where competitors rank in top 10 but the target site has no ranking presence.

Using the keyword ranking data for {site_url} and competitors {competitor_list}, identify all keywords where at least two competitors rank in positions 1–10 but {site_url} does not appear in the top 50. Cluster these keywords by topic, estimate monthly search volume, and prioritize by traffic opportunity and content gap type...
rankingcompetitor-gapkeywords
Technical v1.0

Edge SEO Redirect Worker

Writes a Cloudflare Worker script to handle SEO-safe redirects and header injections at the edge.

Write a Cloudflare Worker script for {site_url} that implements the following redirect rules: {redirect_rules_list}. The script must: return 301 for permanent redirects, preserve query strings where specified, inject canonical headers for parameterized URLs, and log redirect events without impacting TTFB. Output the complete Worker script with deployment instructions...
technicaledge-seocloudflare
Technical v1.0

Hreflang XML Sitemap Config

Builds a correct hreflang XML sitemap configuration for a multi-locale site.

Generate a valid hreflang XML sitemap for {site_url} supporting the following locales: {locale_list}. For each URL set, include all required xhtml:link hreflang annotations with correct ISO locale codes, self-referencing entries, and x-default designation. Output the sitemap XML structure with 3 example URL entries and a validation checklist...
technicalhreflangsitemap
Ranking v1.0

Image SERP Schema Brief

Creates a structured brief to improve image SERP visibility through metadata and schema improvements.

Audit the image SEO signals for the top 20 images on {site_url} that target the keyword cluster '{image_topic}'. Evaluate: alt text relevance, filename descriptiveness, surrounding text context, ImageObject schema, page load speed, and EXIF data. Output a prioritized fix list and a template for future image uploads...
rankingimage-serpschema
Technical v1.0

INP Interaction Event Trace

Traces and diagnoses the root cause of poor INP scores by analyzing interaction event timings.

Analyze the following INP trace data for {page_url}: {inp_trace_data}. Identify the interaction type (click, keypress, tap) causing the longest input delay, processing time, and presentation delay. Pinpoint the responsible JavaScript functions or render-blocking tasks. Output a root-cause diagnosis with specific code-level fixes and expected INP improvement...
technicalinpcwv
Technical v1.0

LCP Resource Chain Fix

Diagnoses the LCP resource load chain and prescribes optimizations to reduce LCP time.

Analyze the following LCP resource load chain data for {page_url}: {lcp_chain_data}. Identify the LCP element, its resource type (image, text, video), and each step in the load chain causing delay (TTFB, render-blocking resources, resource discovery, load delay). Output a prioritized fix list with implementation code for each bottleneck...
technicallcpcwv
GEO v1.0

LLM Source Authority Signals

Models the content and authority signals that make a source preferred by LLMs for a topic area.

Analyze the top 10 sources cited by LLMs (ChatGPT, Perplexity, Claude) for queries related to {topic}. Identify common attributes: domain authority range, content depth, publication recency, schema usage, author credentials, and citation network. Output a weighted signal model {brand_domain} can use to close the citation gap...
geoauthorityllm
Ranking v1.0

Local Pack Competitor Signals

Compares local pack ranking signals between a target business and its top local competitors.

Compare the local pack ranking signals for {business_name} against the top 3 competitors ranking for '{target_local_query}' in {location}. Analyze: GBP completeness, review count/velocity, citation consistency, on-page local signals, and proximity factors. Output a gap table with prioritized actions to improve local pack position...
rankinglocal-packlocal-seo
Audit v1.0

Log File Segment Classifier

Classifies log file entries by bot type, frequency, and crawl pattern to surface SEO insights.

You are an SEO log file analyst. Given the following log file sample for {site_url}, segment entries by bot (Googlebot, Bingbot, other), request frequency, and URL type. Highlight pages receiving disproportionate crawl attention and those being ignored...
auditlog-filecrawl
GEO v1.0

Multi-LLM Citation Gap Test

Tests the same queries across multiple LLMs to reveal where brand citations are missing.

For the query '{target_query}', record the full responses from ChatGPT (GPT-4o), Claude 3.5, Perplexity, and Gemini. Map which sources each LLM cites, identify where {brand_domain} is absent, and diagnose the likely content or authority gap preventing citation in each model. Output a model-by-model remediation table...
geomulti-llmcitation
Audit v1.0

Redirect Chain Impact Audit

Analyzes redirect chains and loops to quantify PageRank dilution and user experience impact.

Analyze the following redirect chain data for {site_url}: {redirect_chain_csv}. Identify chains longer than 2 hops, redirect loops, and mixed HTTP/HTTPS redirects. Output a fix-priority table showing each chain, hop count, estimated equity loss, and recommended single-hop consolidation...
auditredirectstechnical
Content v1.0

Topic Cluster Gap Map

Maps gaps in an existing topic cluster by comparing published content against the full subtopic universe.

Analyze the existing content cluster around the pillar topic '{pillar_topic}' on {site_url}. Compare published URLs against the full subtopic universe (use PAA, related searches, and competitor content as reference). Identify missing subtopics, underserved angles, and hub-spoke link gaps. Output a prioritized content creation queue...
contenttopic-clustergap-analysis
Technical v1.0

Schema Markup Generator Spec

Generates complete, validated JSON-LD schema markup for a specified page type and entity.

Generate complete JSON-LD schema markup for a {page_type} page on {site_url} representing the entity {entity_name}. Include all required and recommended properties for the schema type {schema_type} per Schema.org specifications. Validate against Google's Rich Results requirements and output the final JSON-LD block with inline comments explaining each property...
technicalschemajson-ld
GEO v1.0

AI Overview Passage Intent Mapper

Maps which content passages on a page align with AI Overview trigger intents for a keyword set.

For the target keyword list {keyword_list}, retrieve current AI Overview responses and identify the specific passage types (definition, step-by-step, comparison, statistic) being surfaced. Map each passage type back to the corresponding content gaps on {site_url}...
geoai-overviewpassage
Ranking v1.0

Branded SERP Gap Feature Plan

Audits branded SERP page 1 for missing rich features and plans content to claim each slot.

Run a branded SERP analysis for {brand_name}. Document all SERP features present (sitelinks, knowledge panel, reviews, FAQs, videos, images, Twitter/X module) and all features absent that competitors display on their branded SERPs. Produce a content and schema plan to claim each missing feature...
rankingbrandedserp-features
GEO v1.0

Citation Recency Freshness Optimizer

Identifies time-sensitive content that risks LLM citation loss due to staleness signals.

Audit the content on {site_url} for the topic cluster {topic_cluster}. For each page, assess freshness signals (last-modified date, recency of cited statistics, publication date schema). Identify pages at risk of being deprioritized by LLMs due to staleness and recommend a refresh sequence with minimum update requirements per page...
geofreshnesscitation
Ranking v1.0

Competitor Rank Gap Opportunity Map

Maps keywords where top competitors rank in positions 1–10 but the target site is absent or below 20.

Using the ranking data for {site_url} and competitors {competitor_list}, identify all keywords where at least one competitor ranks in positions 1–10 and {site_url} ranks outside the top 20 or is unranked. Cluster by topic, estimate traffic opportunity, and prioritize by difficulty-to-opportunity ratio...
rankingcompetitor-gapkeyword
Content v1.0

Content Refresh Decay Priority Matrix

Scores decaying content pages by traffic loss rate and refresh ROI to prioritize the update queue.

Analyze the GSC performance data for {site_url} over the past {months} months. Identify all pages with declining click trends (>20% drop YoY). Score each page by: traffic loss rate, ranking position change, content age, competitive gap size, and estimated recovery potential. Output a prioritized refresh queue with recommended update scope per page...
contentcontent-decayrefresh
GEO v1.0

Entity Salience Gap Brief

Identifies entity associations missing from brand content that reduce LLM citation salience.

Analyze the top 5 LLM-cited sources for {target_topic} and extract the entity co-mention patterns (organizations, people, concepts, products). Compare against {site_url} content and produce a brief listing the missing entity associations, recommended placement, and supporting content formats...
geoentitysalience
Content v1.0

FAQ Block SERP Intent Generator

Generates FAQ blocks aligned to PAA questions for a target keyword, ready for FAQPage schema markup.

For {target_keyword} and the related PAA questions {paa_questions}, write a 5–8 question FAQ block for {page_url}. Each answer must be 40–60 words, directly answer the question, and be formatted for FAQPage JSON-LD schema. Ensure answer language matches the intent of each question (informational vs. commercial)...
contentfaqschema
GEO v1.0

GEO Content Brief Passage Optimizer

Creates a GEO-optimized content brief focused on passage structures most cited by AI models.

For the topic {target_topic}, analyze the passage formats most frequently cited by AI Overviews and Perplexity (definitions, numbered steps, tables, statistics). Write a detailed content brief for {site_url} specifying required passage types, word-count targets, and entity co-mentions needed for LLM citation eligibility...
geocontent-briefpassage
Content v1.0

Internal Link Anchor Text Planner

Plans anchor text variations for an internal linking strategy that avoids over-optimization penalties.

For the target page {target_url} on {site_url} ranking for {primary_keyword}, audit all existing internal links pointing to it and their anchor text. Recommend a diversified anchor text plan (exact match, partial match, branded, generic, naked URL) with specific ratio targets and suggested source pages for each new link...
contentanchor-textinternal-links
Audit v1.0

JavaScript Content Render Delta Checker

Compares raw HTML vs. rendered DOM for key pages to identify content invisible to crawlers.

For each URL in {url_list} from {site_url}, compare the raw HTML source against the fully rendered DOM. Identify all content elements, internal links, and schema markup present only in the rendered version, and classify each gap by SEO risk level...
auditjavascriptrendering
Ranking v1.0

Knowledge Panel Claim Optimizer

Identifies missing or inaccurate attributes in a brand's Google Knowledge Panel and prescribes fixes.

Audit the Google Knowledge Panel for {brand_name}. List all displayed attributes (description, founding date, founders, products, social profiles) and compare against the correct values in {source_data}. For each discrepancy or missing attribute, prescribe the on-site structured data change or third-party entity signal needed to correct it...
rankingknowledge-panelentity
GEO v1.0

LLM Source Authority Gap Finder

Diagnoses why a domain is deprioritized as a source by LLMs and surfaces corrective actions.

For the topic cluster {topic_cluster}, compare the authority signals (backlink profile, author credentials, publication recency, structured data) of domains frequently cited by LLMs against {domain}. Identify the top 5 authority gaps and recommend specific actions to close each...
geoauthorityllm
Ranking v1.0

Local Pack NAP Consistency Audit

Audits Name, Address, Phone consistency across GBP, site, and citation sources for local pack ranking.

For {business_name} at {location}, compare NAP data across the Google Business Profile, {site_url} contact and footer pages, and the top 10 citation sources ({citation_list}). Flag every inconsistency, score overall NAP health, and prioritize correction by citation domain authority...
rankinglocal-seonap
Audit v1.0

Log File Bot Ratio Analyzer

Analyzes server log data to surface Googlebot crawl ratios vs. other bots and flag anomalies.

Given the following server log extract for {site_url}, calculate the ratio of Googlebot requests to total bot traffic, identify crawl frequency spikes or drops, and flag any URLs receiving disproportionate bot attention: {log_data}...
auditlog-filecrawl
Content v1.0

Meta Title CTR Rewrite Batch

Batch-rewrites title tags for low-CTR pages using SERP competitor analysis and power-word patterns.

For the following pages on {site_url} with below-average CTR: {page_list}, analyze the current title tags and the top 5 SERP competitor titles for each target keyword. Rewrite each title tag to improve CTR using power words, number inclusion where applicable, and 50–60 character limits. Provide before/after comparison and rationale for each change...
contenttitle-tagctr
Ranking v1.0

News SERP Freshness Signal Planner

Plans publishing cadence and markup changes to improve Top Stories and News SERP eligibility.

For the news topic cluster {topic_cluster}, analyze the Top Stories SERP features for {keyword_list}. Document the publication velocity, article schema usage, headline patterns, and site authority signals of consistently appearing sources. Produce a publishing and markup plan for {site_url} to achieve Top Stories eligibility...
rankingnews-serptop-stories
Audit v1.0

Orphan Page Traffic Opportunity Audit

Cross-references crawl data with GSC traffic to surface orphaned pages that still earn impressions.

Using the crawl export and Google Search Console data for {site_url}, identify all pages with zero internal links that still receive organic impressions. Prioritize by impression volume and recommend the most logical internal linking targets...
auditorphan-pagesinternal-links
Audit v1.0

Redirect Loop Chain Tracer

Maps multi-hop redirect chains and loops from a URL list, flagging equity loss and fix priority.

Analyze the following list of URLs and their redirect responses for {site_url}: {redirect_data}. Identify all chains longer than 2 hops, any redirect loops, and calculate estimated PageRank equity loss per chain. Output a fix-priority table...
auditredirectstechnical
GEO v1.0

Perplexity Domain Citation Profile

Profiles how often and in what context Perplexity cites a given domain across a topic cluster.

For the topic cluster {topic_cluster}, query Perplexity with 10 representative questions and record every source cited. Build a citation frequency profile for {domain}, noting the query types, citation position (primary vs. supplementary), and content formats that drive inclusion...
geoperplexitycitation
Audit v1.0

Schema Markup Type Gap Scanner

Identifies missing schema types across key page templates compared to top-ranking competitors.

Compare the schema markup present on {site_url} page templates against the top 5 ranking competitors for {target_keyword}. List all schema types used by competitors but absent from {site_url}, ranked by rich-result eligibility...
auditschemarich-results
Content v1.0

Topic Cluster Gap Content Planner

Identifies spoke-page gaps in an existing topic cluster and generates a prioritized creation roadmap.

Audit the existing topic cluster for {pillar_topic} on {site_url}. Map current spoke pages against the full keyword universe for this cluster. Identify spoke gaps (keywords with search volume but no targeting page), prioritize by traffic opportunity, and generate a content creation roadmap with working titles and target keyword assignments...
contenttopic-clustergap-analysis
Technical v1.0

XML Sitemap Priority Config Engineer

Engineers an XML sitemap configuration with correct priority/changefreq values and index-split architecture.

Design the XML sitemap architecture for {site_url} with the following URL segments: {url_segments}. Specify: individual sitemap files per content type, correct priority values (0.0–1.0) based on page strategic value, appropriate changefreq declarations, and sitemap index file structure. Flag any URLs that should be excluded from sitemaps despite being indexable...
technicalsitemapxml
Content v1.0

Anchor Text Diversity Gap Brief

Diagnoses over-optimized or monotonous anchor text profiles and recommends a diversification strategy.

Analyze the internal anchor text distribution for {target_url} on {site_url} using the crawl export: {anchor_csv}. Identify: over-optimized exact-match anchors, missing topical variation, and pages with anchor mismatches vs their content. Output a diversification plan with specific rewrite recommendations for the top 20 internal links...
contentanchor-textinternal-links
Ranking v1.0

Branded Query Impression Gap Audit

Identifies branded queries where competitors or third parties outrank the brand in its own SERP.

Using GSC data for {site_url} and SERP snapshots for the branded queries {branded_query_list}, identify positions where competitor pages, review sites, or aggregators outrank {brand_name} brand pages. Rank by impression volume and recommend defensive content, structured data, or technical actions for each...
rankingbranded-queriesserp-ownership
Audit v1.0

Canonical Self-Reference Conflict Audit

Detects canonical tags pointing to non-indexable, redirected, or conflicting alternate URLs.

Review the canonical tag data for {site_url} from the crawl export below: {crawl_csv}. Identify canonicals pointing to: redirected destinations, noindex pages, paginated variants without proper handling, or cross-domain URLs without intent. Output a severity-ranked fix list...
auditcanonicalindexing
GEO v1.0

ChatGPT Entity Salience Readiness

Evaluates how prominently a brand entity is represented in ChatGPT responses for target queries.

Ask ChatGPT the following {n} queries related to {brand} operating in {industry}: {query_list}. Record every mention, sentiment, and context. Score entity salience on a 1-10 scale per query, identify omission patterns, and recommend content and PR actions to improve brand entity prominence...
geochatgptentity-salience
GEO v1.0

Claude Response Coverage Tester

Tests how comprehensively Claude covers a topic and flags content angles absent from its responses.

Submit these {n} queries about {topic} to Claude and capture full responses: {query_list}. Identify sub-topics covered, sub-topics omitted, and sources explicitly cited or implied. Compare coverage against {site_url} content and output a brief of content angles to create or expand for improved Claude inclusion...
geoclauderesponse-coverage
Ranking v1.0

Competitor Content Rank Gap Scorer

Scores competitor pages outranking your site to surface the specific content factors driving the gap.

For the queries where {competitor_domain} outranks {site_url}: {keyword_list}, compare the top-ranking competitor page against your equivalent page for each query. Score gaps across: content depth, heading structure, E-E-A-T signals, internal linking, schema, and page speed. Output a weighted gap score and fix brief per query...
rankingcompetitor-gapcontent-quality
Content v1.0

Content Brief SERP Entity Map

Builds a content brief that maps required entities from top-ranking SERP pages for a target keyword.

Analyze the top 10 ranking pages for {target_keyword} and extract all named entities (people, places, organizations, concepts) they share. Map entity frequency and co-occurrence patterns. Output a content brief for {site_url} that specifies which entities to include, their recommended mention density, and supporting semantic context...
contentcontent-briefentity-mapping
Content v1.0

Content Decay Refresh Brief Builder

Produces a targeted refresh brief for a decaying page based on traffic loss and SERP shift analysis.

The following page on {site_url} has experienced a {traffic_drop_pct}% traffic decline since {decline_date}: {page_url}. Analyze the current SERP for its primary keyword {target_keyword}, identify what top-ranking pages now include that this page lacks, and output a structured refresh brief with specific section rewrites, new entity inclusions, and schema updates...
contentcontent-decaycontent-refresh
Content v1.0

Content Outline Question Intent Mapper

Structures a content outline by mapping each heading to a distinct searcher intent question it answers.

Create a detailed content outline for a page targeting {primary_keyword} on {site_url}. For each H2 and H3 section, specify: the underlying searcher question it answers, the intent type (informational/commercial/navigational), the recommended word count, and any supporting schema type. Align the outline with current top-3 SERP structures...
contentcontent-outlinesearch-intent
Audit v1.0

CrUX Field Data Gap Auditor

Compares CrUX field data against lab scores to surface real-user experience gaps by page segment.

Compare the following CrUX field data and PageSpeed lab results for {site_url} across these page segments: {segments}. Identify metrics where field and lab diverge by more than 20%, hypothesize root causes (e.g., third-party scripts, layout shifts, TTFB), and rank fixes by user impact...
auditcore-web-vitalscrux
Content v1.0

FAQ Block PAA Intent Builder

Generates FAQ schema content blocks derived from PAA questions for a target keyword cluster.

Extract People Also Ask questions for the keyword cluster {topic} from Google SERPs. For each question, write a concise, factually accurate answer (40-60 words) optimized for featured snippet extraction. Output the full FAQ section as both editorial HTML and a ready-to-deploy FAQPage JSON-LD schema block...
contentfaq-schemapaa
GEO v1.0

Generative SERP Snippet Fit Audit

Audits whether existing content passages are structurally fit for extraction by generative SERP features.

Review the top 10 pages of {site_url} by organic traffic impressions. For each page, extract the first three candidate passages and score them on: answer completeness within 40 words, factual density, entity specificity, and heading-question alignment. Output a rewrite priority list with before/after passage examples...
geogenerative-serppassage-extraction
Technical v1.0

INP LCP Interaction Trace Fix

Traces INP and LCP bottlenecks to specific DOM elements and script interactions for root-cause fixing.

Using the Chrome DevTools performance trace and Web Vitals report for {page_url}: {trace_data}, identify: the LCP element and its resource load chain, the highest-INP interaction event and its blocking scripts, and any CLS layout shift sources. For each, output a specific code-level fix with estimated metric improvement...
technicalcore-web-vitalsperformance
Audit v1.0

Internal Link Depth Bottleneck Audit

Surfaces high-value pages buried beyond three clicks from the homepage due to shallow internal linking.

Given the crawl depth report for {site_url}: {depth_csv}, identify all pages with significant GSC impressions that sit more than 3 clicks from the homepage. Rank them by traffic potential and recommend specific internal link placements on shallower pages to elevate their crawl priority...
auditinternal-linkscrawl-depth
Ranking v1.0

Knowledge Panel Data Gap Audit

Identifies missing or incorrect attributes in Google's Knowledge Panel for a brand or entity.

Review the current Google Knowledge Panel for {entity_name} and compare its attributes against: the brand's official website data, Wikidata entries, and structured data implementations on {site_url}. List every missing, incorrect, or outdated attribute and recommend Schema.org and off-site actions to correct each...
rankingknowledge-panelentity
GEO v1.0

LLM Brand Sentiment Shift Audit

Tracks sentiment changes in how LLMs describe a brand over time across multiple model versions.

Query ChatGPT, Claude, and Perplexity with the following brand-related prompts for {brand}: {prompt_list}. For each response, classify sentiment as positive, neutral, or negative, extract key descriptor phrases, and compare against baseline recorded on {baseline_date}. Flag sentiment regressions and recommend corrective content actions...
geobrand-mentionsentiment
Audit v1.0

Mobile Content Parity Auditor

Checks whether critical on-page content and structured data are fully present in mobile-rendered HTML.

Using the desktop vs. mobile rendered HTML pairs below for {site_url}: {html_pairs}, identify any content, headings, internal links, or structured data present on desktop but absent or truncated on mobile. Flag each gap by SEO priority and recommend implementation fixes...
auditmobile-firstrendering
GEO v1.0

Multi-LLM Source Format Tester

Tests whether content format changes affect citation rates across ChatGPT, Claude, and Perplexity.

Submit the following content variants for {topic} to ChatGPT, Claude, and Perplexity: {variant_list}. For each variant, record whether it is cited, paraphrased, or ignored. Produce a cross-LLM matrix showing which format elements (headers, bullets, tables, prose length) correlate with citation...
geomulti-llmcontent-format
Audit v1.0

Orphan Page Priority Finder

Ranks orphaned pages by traffic potential to help prioritize internal linking recovery efforts.

Given this list of orphan pages for {site_url} with their GSC impression and click data: {csv_data}, rank them by recovery priority using estimated traffic opportunity, page quality signals, and topical relevance. Suggest the top internal link placements for each...
auditorphan-pagesinternal-links
Ranking v1.0

PAA Intent Gap Expander

Mines People Also Ask boxes for intent gaps not addressed by existing content on the target site.

Extract all PAA questions surfaced across the following queries for {topic}: {query_list}. Cross-reference against the existing content inventory of {site_url}. Identify PAA questions with no matching content, group by intent type (informational, navigational, commercial), and recommend content additions or expansions...
rankingpaaintent-gap
GEO v1.0

Perplexity Competitor Citation Mapper

Maps which competitor domains Perplexity cites most for a given topic cluster and why.

Run the following 10 queries related to {topic} in Perplexity and record all cited sources: {query_list}. For each competitor domain cited more than twice, analyze: content format, heading structure, source authority signals, and freshness. Output a gap brief for {site_url} to compete for citations...
geoperplexitycompetitor-analysis
Audit v1.0

Redirect Loop Chain Detector

Detects redirect loops and chains longer than two hops that waste crawl budget and dilute equity.

Using the redirect map below for {site_url}: {redirect_csv}, identify all chains exceeding 2 hops, any circular redirect loops, and URLs that lose significant link equity. Output a fix plan with consolidated target URLs and recommended 301 consolidations...
auditredirectscrawl-budget
Technical v1.0

Robots.txt Crawl Directive Audit

Audits robots.txt for directives that accidentally block indexable content or waste crawl budget.

Analyze the robots.txt file for {site_url}: {robots_txt_content}. Identify: disallow rules blocking indexable pages, conflicting allow/disallow patterns, Googlebot-specific vs wildcard conflicts, missing crawl-delay considerations, and sitemap declaration accuracy. Output a risk-ranked directive audit with corrected rules...
technicalrobots-txtcrawl-budget
Technical v1.0

Schema Markup JSON-LD Validator

Validates JSON-LD schema blocks for syntax errors, missing required fields, and rich result eligibility.

Validate the following JSON-LD schema blocks from {site_url}: {schema_blocks}. For each block, check: JSON syntax validity, required vs recommended property completeness per schema.org spec, Google rich result eligibility requirements, and nested entity accuracy. Output an error report with a corrected version of each invalid block...
technicaljson-ldschema-validation
Audit v1.0

Schema Type Coverage Checker

Evaluates which Schema.org types are missing or incomplete across key page templates.

Review the following list of page templates for {site_url}: {template_list}. For each, identify which Schema.org types are absent or partially implemented, flag rich-result eligibility gaps, and output a remediation checklist ordered by estimated SERP impact...
auditschemarich-results
Ranking v1.0

SERP Volatility Query Cluster Tracker

Tracks SERP rank instability across a query cluster and attributes volatility to likely algorithmic causes.

Using the 90-day rank tracking data for {site_url} across this query cluster: {keyword_csv}, identify queries with standard deviation greater than 5 positions. For each volatile cluster, cross-reference against Google algorithm update dates, content change logs, and SERP feature shifts. Output a cause-attribution and stabilization brief...
rankingserp-volatilityalgorithm
Ranking v1.0

Shopping SERP Feed Schema Gap

Audits product feed and on-page schema for gaps preventing Shopping SERP and free listing inclusion.

Audit the top 20 product pages on {site_url} for Shopping SERP eligibility. Check: Product schema completeness (price, availability, brand, GTIN), Merchant Center feed alignment, review snippet eligibility, and structured data errors from Search Console. Output a ranked fix list with corrected schema snippets...
rankingshopping-serpproduct-schema
Audit v1.0

Log Anomaly Site Audit

Identifies crawl anomalies and unexpected bot behavior patterns from raw server log data.

Analyze the following server log excerpt for {site_url} and identify: (1) unexpected crawl spikes, (2) URLs receiving disproportionate bot visits vs traffic, (3) error-heavy paths, and (4) segments to deprioritize in crawl budget. Output a prioritized action table...
auditlog-filecrawl-budget
Ranking v1.0

Branded Query Impression Plan

Builds a strategy to expand branded query impression share and SERP feature ownership for a brand.

You are a branded SEO strategist. Using GSC data for {brand_domain}, identify all branded and brand-adjacent queries where {brand_name} appears but does not hold a featured snippet, sitelink, knowledge panel, or other SERP feature. Prioritise by impression volume and produce a content and schema action plan to capture each feature...
rankingbrandedserp-features
Technical v1.0

CDN Cache-Control SEO Config

Configures CDN cache-control headers to balance crawl freshness with server load for SEO.

Act as a CDN and SEO infrastructure engineer. For the site {site_url} served via {cdn_provider}, configure Cache-Control and Surrogate-Control headers for the following URL patterns: {url_pattern_list}. For each pattern, specify: max-age value, s-maxage for CDN TTL, stale-while-revalidate settings, and Vary header requirements. Justify each setting's impact on Googlebot crawl freshness...
technicalcdncache-control
Content v1.0

Content Brief Intent Match

Generates a content brief precisely aligned to the dominant SERP intent for a target keyword.

Act as a content strategist. For the target keyword {target_keyword}, analyze the top 10 ranking URLs and classify the dominant search intent (informational, navigational, commercial, transactional). Then produce a full content brief for {brand_domain} including: recommended content format, target word count, required headings, primary entities to cover, and E-E-A-T signals to include...
contentbriefintent
Audit v1.0

Duplicate Content Parameter Check

Identifies URL parameter combinations generating near-duplicate pages and recommends canonical or noindex fixes.

You are a duplicate content specialist. For the site {site_url}, analyze the provided list of parameterised URLs {url_list}. Group URLs by content similarity score, identify which parameter combinations create duplicate or near-duplicate pages, and recommend the correct resolution for each group: canonical, noindex, or parameter handling in GSC...
auditduplicate-contentcanonicals
Ranking v1.0

Image SERP Gap Analyzer

Identifies image SERP ranking opportunities and the structured data and file signals needed to capture them.

Act as an image SEO strategist. For the query set {query_list}, audit the current image SERP: dominant image types, alt text patterns, file naming conventions, host domain authority, and structured data used by ranking images. Identify gaps for {brand_domain} and produce an image optimisation action plan with schema recommendations...
rankingimage-serpstructured-data
GEO v1.0

LLM Source Authority Gap Audit

Identifies which authority signals your domain lacks that cause LLMs to prefer competitor sources.

Act as a GEO source authority analyst. Compare the citation authority profile of {brand_domain} against the top 3 domains cited by LLMs for queries in {topic_area}. Identify missing signals: backlink profile gaps, DR disparity, Wikipedia mentions, press coverage breadth, and schema completeness. Produce a signal-building action plan...
geoauthorityllm
Ranking v1.0

Local Pack Signal Gap Report

Identifies GBP, citation, and on-page signal gaps preventing a business from ranking in the Local Pack.

You are a local SEO analyst. For the business {business_name} targeting the query {target_query} in {location}, compare its Google Business Profile completeness, NAP citation consistency, review velocity, and local on-page signals against the three current Local Pack winners. Produce a ranked gap-fix plan...
rankinglocal-packlocal-seo
Audit v1.0

Orphan Page Equity Gap

Identifies orphaned pages that receive no internal links and ranks them by organic traffic potential.

You are a technical SEO auditor. Using the crawl data export for {site_url}, identify all URLs that receive zero internal links from other crawled pages. Cross-reference against Google Search Console impressions data to rank orphans by potential traffic impact and recommend link-insertion targets...
auditorphan-pagesinternal-links
Content v1.0

Meta Description CTR Batch Rewrite

Rewrites a batch of meta descriptions to improve CTR using SERP-tested copywriting frameworks.

You are a SERP copywriting specialist. For the following list of page URLs and their current meta descriptions {url_meta_list}, rewrite each meta description to: include the primary keyword naturally in the first 60 characters, add a specific value proposition or number, include an action-oriented phrase, and stay within 155 characters. Output as a table with old vs. new side-by-side...
contentmeta-descriptionctr
Ranking v1.0

PAA Intent Depth Miner

Extracts and clusters People Also Ask questions to uncover deep intent layers around a seed topic.

You are a SERP intent analyst. For the seed keyword {seed_keyword}, extract the first three levels of People Also Ask questions (seed → level 1 → level 2). Cluster them by intent sub-type (informational, navigational, commercial, transactional), identify content gaps on {brand_domain}, and recommend FAQ or section additions for each cluster...
rankingpaaintent
Technical v1.0

Prerender Eligibility Audit Spec

Evaluates which page types qualify for prerendering and specifies the correct implementation approach.

Act as a prerendering and SEO technical specialist. For the site {site_url}, evaluate each page template in {template_list} for prerender eligibility based on: JavaScript dependency complexity, dynamic content requirements, personalisation or authentication gates, and Googlebot compatibility. For eligible templates, specify the prerendering method (Rendertron, Prerender.io, or native SSR) and configuration...
technicalprerenderingrendering
Content v1.0

Programmatic Content Template Design

Designs a scalable programmatic content template for location or category pages with dynamic variables.

You are a programmatic SEO architect. For the page type {page_type} on {brand_domain}, design a content template that scales across {variable_count} variations of {variable_name}. Specify: required static sections, dynamic variable slots, minimum unique content percentage per page, internal linking logic, and the schema markup type to include. Include a sample rendered page for {sample_variable}...
contentprogrammatictemplate
Technical v1.0

Robots.txt Crawl Scope Config

Generates a robots.txt file that precisely scopes Googlebot crawl access by URL pattern and bot type.

You are a technical SEO engineer. For the site {site_url}, generate a robots.txt file that: allows Googlebot full access to {allow_paths}, disallows crawling of {disallow_paths}, sets a crawl-delay for {non-priority_bots}, and includes the XML sitemap URL. Explain each directive's SEO rationale and flag any conflicts with existing meta robots tags...
technicalrobots-txtcrawl
Technical v1.0

XML Sitemap Index Split Config

Designs a sitemap index split strategy for large sites to optimise crawl prioritisation by URL type.

Act as a technical SEO architect. For the site {site_url} with {total_url_count} indexable URLs, design a sitemap index structure that splits URLs into logical child sitemaps by type: {url_type_list}. Specify: file naming convention, maximum URLs per child sitemap, priority and changefreq values per URL type, update frequency, and submission strategy in GSC. Output the sitemap index XML shell...
technicalsitemapcrawl
Content v1.0

Content Decay Page Recovery Brief

Diagnose the root causes of traffic decline on a page and produce a targeted refresh brief.

Given Google Search Console and Analytics data for {page_url} showing a traffic decline over {time_period}, identify: (1) which queries have lost impressions or clicks, (2) SERP changes (new competitors, new features, intent shift) driving the decline, (3) content freshness gaps. Produce a prioritized refresh brief with specific section rewrites and new content additions...
contentcontent-decayrefresh
Audit v1.0

Core Web Vitals CrUX Segment Diagnosis

Diagnose CrUX field data discrepancies across device segments to pinpoint real-user performance gaps.

Given the following CrUX field data export for {domain} segmented by mobile, tablet, and desktop: {crux_data}, identify which page groups fail Core Web Vitals thresholds per segment, surface the root element candidates for LCP and CLS failures, and recommend a phased remediation roadmap...
auditcore-web-vitalscrux
Content v1.0

Content Gap Competitor Angle Map

Compare competitor content coverage against yours to surface unaddressed topic angles.

Compare the content inventories of {competitor_list} against {domain} for the topic cluster "{topic_cluster}". For each competitor, identify: (1) topics they rank for that {domain} does not cover, (2) the content angle and format used, (3) estimated monthly traffic value. Prioritize gaps by traffic opportunity and output a content creation brief for the top 5 gaps...
contentcontent-gapcompetitor
Audit v1.0

Faceted Nav Parameter Waste Audit

Audit faceted navigation URL parameters to identify crawl waste and duplicate indexation risks.

Review the following faceted navigation parameter combinations for {domain}: {parameter_list}. Classify each parameter as (1) index-and-follow, (2) noindex-follow, (3) disallow, or (4) canonical-to-root, based on search volume potential and content uniqueness. Output a robots.txt and meta-robots action plan...
auditfaceted-navcrawl-budget
Content v1.0

FAQ Entity Schema Block Builder

Generate FAQ content blocks enriched with entity context and FAQPage schema markup.

For the page {page_url} targeting the topic "{topic}", generate 8 FAQ items that: (1) target distinct PAA and long-tail intents, (2) include named entity mentions that signal topical authority, (3) are formatted as concise, self-contained answers under 60 words each. Output each FAQ item with its FAQPage JSON-LD schema snippet ready to paste...
contentfaqschema
GEO v1.0

GEO Topical Authority Cluster Plan

Design a topical cluster content plan specifically engineered to build LLM citation authority.

For the primary topic {primary_topic}, build a GEO-optimized topical authority cluster plan for {domain}. Include: (1) a hub page brief targeting broad definitional queries, (2) 8-12 spoke page briefs targeting specific sub-queries LLMs answer frequently, (3) entity linkage recommendations, and (4) citation signal requirements per page...
geotopical-authoritycontent-cluster
Ranking v1.0

Knowledge Panel Attribute Gap Filler

Identify missing knowledge panel attributes for a brand entity and prescribe structured data fixes.

Retrieve the current Google Knowledge Panel for {brand_name}. List every attribute field shown and compare against the full attribute set available for {entity_type} in Google's Knowledge Graph. For each missing attribute, identify the structured data property (schema.org), the recommended on-site implementation, and a supporting third-party source to corroborate the signal...
rankingknowledge-panelentity
GEO v1.0

LLM Source Authority Gap Model

Model why certain domains are preferred by LLMs as sources and identify gaps for your domain.

Given the following set of LLM citations for the topic {topic} collected across {llm_list}: {citation_data}, analyze the shared authority signals of the most-cited domains (backlink profile, entity prominence, content structure, publication frequency). Identify the specific signals where {domain} underperforms and output a prioritized authority gap action plan...
geosource-authorityllm
GEO v1.0

Multi-LLM Answer Coverage Gap Test

Compare how ChatGPT, Claude, Gemini, and Perplexity answer the same query to find brand citation gaps.

Submit the query "{target_query}" to ChatGPT, Claude, Gemini, and Perplexity. Record each response verbatim. Then analyze: (1) which sources are cited per LLM, (2) whether {brand_name} appears in any response, (3) factual or framing differences across LLMs, and (4) a prioritized brief to improve presence in the LLMs where {brand_name} is absent...
geomulti-llmcitation
Ranking v1.0

People Also Ask Intent Gap Builder

Mine PAA boxes for a keyword set to surface unanswered question intents in your content.

For the seed keywords {keyword_list}, extract all People Also Ask questions appearing on page 1 of Google. Group them by intent sub-type (definitional, comparative, procedural, troubleshooting). Identify which questions {domain} does not currently answer on any indexed page and output a prioritized FAQ content gap list...
rankingpaacontent-gap
GEO v1.0

Perplexity Citation Source Gap Brief

Identify content and authority gaps preventing your domain from being cited by Perplexity AI.

For the topic cluster {topic_cluster}, run the following queries in Perplexity: {query_list}. Document every source cited. Compare against {domain}'s content inventory. Identify: (1) query intents where {domain} has content but is not cited, (2) structural differences between cited sources and your pages, and (3) a gap remediation brief...
geoperplexitycitation
Technical v1.0

Prerender Eligibility Config Planner

Evaluate and configure prerendering eligibility for key page templates to improve crawl readiness.

Assess the following page templates on {domain} for prerendering eligibility: {template_list}. For each template, evaluate: (1) dynamic content that would differ between prerender and user views, (2) authentication-gated content risks, (3) JavaScript execution requirements. Output a prerender configuration spec including Speculation Rules API implementation where applicable...
technicalprerenderingrendering
Technical v1.0

Robots.txt Crawl Budget Directive Plan

Design robots.txt directives to protect crawl budget by blocking non-value URL patterns.

Given the following crawl report for {domain} showing all crawled URL patterns and their indexing value scores: {crawl_data}, write an optimized robots.txt file that: (1) disallows low-value URL patterns (facets, session IDs, internal search), (2) preserves access to all indexable templates, (3) references the XML sitemap. Explain each disallow directive...
technicalrobots-txtcrawl-budget
Ranking v1.0

Shopping SERP Feed Attribute Optimizer

Diagnose and optimize product feed attributes to improve Google Shopping SERP performance.

Review the following product feed extract for {domain}: {feed_sample_csv}. For each product, evaluate: (1) title keyword relevance and format compliance, (2) completeness of GTIN, MPN, brand attributes, (3) image quality signals, (4) price competitiveness relative to SERP. Output a prioritized attribute fix list ranked by estimated impression uplift...
rankingshopping-serpproduct-feed
Audit v1.0

Technical Site Crawl Log Audit

Analyze server log files to surface crawl anomalies, bot frequency issues, and wasted crawl budget.

You are an SEO engineer. Given the following server log data for {domain}, identify: (1) pages crawled too frequently vs. infrequently, (2) non-canonical URLs consuming crawl budget, (3) bot segments beyond Googlebot, and (4) actionable directives to resolve each issue. Output a prioritized table...
auditlog-filecrawl-budget
Audit v1.0

Canonical Chain Resolution Audit

Detects multi-hop canonical chains and conflicting canonical signals across page variants.

Review the following canonical tag data for {domain}: {canonical_map}. Identify any canonical chains (A→B→C), self-referencing contradictions, or pages where the canonical conflicts with the sitemap URL. Output a resolution table with recommended canonical target per URL...
auditcanonicaltechnical
Technical v1.0

Hreflang Locale XML Config Builder

Generates a complete hreflang XML sitemap configuration for a multi-locale site with return tag validation.

Generate a valid hreflang XML sitemap for {domain} supporting the following locale/URL mappings: {locale_url_map}. Ensure every URL includes the full set of hreflang annotations including x-default, correct ISO 639-1 language and ISO 3166-1 country codes, and reciprocal return tags. Output as valid XML...
technicalhreflangsitemap
GEO v1.0

LLM Recency Freshness Signal Planner

Plans content freshness signals to improve recency-weighted LLM citation selection for time-sensitive topics.

For {domain}'s content on the time-sensitive topic '{topic}', design a freshness signal strategy to improve recency-weighted LLM citations. Include: update frequency schedule, date markup patterns, change-log section format, and re-syndication trigger criteria. Output as a 90-day editorial calendar...
geofreshnessllm
Ranking v1.0

PAA Intent Expansion Brief

Mines People Also Ask trees for a seed query to build a full intent-expansion content brief.

Starting from the seed query '{seed_query}', extract all first- and second-level People Also Ask questions from Google SERPs. Group them by intent sub-type, identify which questions {domain} currently has no content addressing, and output a prioritized content expansion brief...
rankingpaacontent-gap
Content v1.0

Title Meta Batch SEO Rewriter

Rewrites a batch of title tags and meta descriptions to maximize SERP CTR and keyword alignment.

Rewrite the following title tags and meta descriptions for {domain}: {url_title_meta_list}. For each URL, apply: primary keyword front-loading, emotional/utility trigger words, character count limits (60/160), and SERP differentiation from listed competitors. Output as a CSV with old and new versions...
contenttitle-metactr
GEO v1.0

AEO Topical Gap Brief

Identifies topical sub-questions your site fails to answer that LLMs are drawing from competitors to answer.

For the primary topic '{primary_topic}', query three LLMs with 15 related sub-questions. Record which sub-questions are answered using competitor sources rather than {your_domain}. Output a prioritized content gap brief with recommended answer formats for each missing sub-topic...
geoaeotopical-authority
Audit v1.0

Canonical Conflict Chain Auditor

Detects self-referential, chained, and conflicting canonical tags that dilute indexing signals.

Using the canonical tag data below for {site_url}, identify all pages where: (a) the canonical points to a URL that itself has a different canonical, (b) the canonical conflicts with a noindex directive, or (c) the canonical differs between HTTP headers and on-page tags. Output a fix priority list...
auditcanonicalindexing
Content v1.0

Content Decay Traffic Triage

Triages a list of decaying content pages into refresh, consolidate, or retire recommendations.

Using the 12-month traffic trend data below for {site_url}'s content pages, identify all URLs with a declining trend of more than {decline_threshold}% in organic sessions. Classify each as: Refresh (strong topic, weak content), Consolidate (duplicate intent), or Retire (no search demand). Output a prioritized action table...
contentcontent-decaytriage
Ranking v1.0

Competitor Ranking Gap Matrix

Builds a side-by-side keyword ranking gap matrix between your site and up to three competitors.

Using the ranking data below for {your_domain} and competitors {competitor_list}, build a gap matrix showing keywords where competitors rank in positions 1–10 but {your_domain} ranks outside position 20 or does not rank. Prioritize gaps by estimated monthly search volume and output a quick-win opportunity list...
rankingcompetitor-gapkeywords
Ranking v1.0

Featured Snippet Format Gap Targeter

Identifies which featured snippet formats competitors hold that your content is not formatted to win.

For the keyword set {keyword_list}, document the current featured snippet holder, snippet type (paragraph/list/table/code), and word count for each. Compare against {your_domain}'s ranking content and output a format-by-format rewrite brief to compete for each snippet position...
rankingfeatured-snippetformat
Ranking v1.0

Image SERP Structured Data Audit

Audits image pages for structured data signals needed to win image SERP rich features.

Crawl the following image-heavy URLs from {site_url}: {url_list}. For each, check for ImageObject schema, descriptive filenames, alt text quality, caption presence, and page context relevance. Output a per-image fix table ranked by estimated image SERP impact...
rankingimage-serpstructured-data
Audit v1.0

Mobile-First Indexing Signal Audit

Checks whether desktop and mobile rendered content parity meets Google mobile-first indexing requirements.

Compare the desktop and mobile rendered HTML snapshots below for {page_url}. Identify any content, structured data, internal links, or metadata present on desktop but absent on mobile, and flag each discrepancy with its SEO risk level...
auditmobile-firstrendering
Ranking v1.0

PAA Intent Mining Expander

Expands a seed keyword into a full People Also Ask intent tree for content and FAQ planning.

Starting with seed keyword '{seed_keyword}', extract and recursively expand the People Also Ask questions appearing on Google SERPs up to three levels deep. Cluster questions by intent type, identify which {your_domain} pages (if any) currently rank for each, and flag content gaps...
rankingpaaintent
Ranking v1.0

Video SERP Clip Schema Planner

Plans VideoObject and Clip schema implementation to maximize video SERP rich result appearances.

For each video asset hosted on {site_url} listed below, generate a VideoObject JSON-LD block including Clip markup with startOffset/endOffset for the most answer-rich segments. Prioritize clips targeting queries in {target_query_list}...
rankingvideo-serpschema
GEO v1.0

AEO Topical Cluster Gap Map

Maps topical cluster gaps that prevent a site from being seen as authoritative enough for AEO/GEO inclusion.

For {brand_domain} targeting the topic cluster {topic_cluster}, identify: (1) subtopics with no existing content, (2) subtopics with content but insufficient depth for LLM citation, (3) competitor domains that cover the full cluster, and (4) a priority content roadmap to close the topical authority gap for AEO/GEO...
geoaeotopical-authority
Audit v1.0

Broken Link Crawl Priority Sweep

Identifies broken internal and external links ranked by page authority to prioritize high-impact fixes.

Using the crawl export for {domain}, list all internal and external links returning 4xx or 5xx status codes. Sort them by the authority of the source page (using {authority_metric}), and for each broken link suggest a replacement target URL or a recommended action (remove, redirect, replace)...
auditbroken-linkscrawl
Content v1.0

Content Brief Entity Depth Spec

Generates a content brief enriched with entities, co-occurrences, and semantic depth targets.

Create a content brief for the target keyword '{keyword}' targeting {audience}. Include: (1) primary and secondary entities to reference, (2) required semantic co-occurrences based on top-ranking pages, (3) recommended heading structure, (4) E-E-A-T signals to include, and (5) word count and content depth targets by section...
contententitybrief
Content v1.0

E-E-A-T Author Bio Spec

Generates an E-E-A-T-optimized author bio template with structured data and credibility signal recommendations.

For the author {author_name} writing about {topic_niche} on {domain}, create an E-E-A-T-optimized author bio. Include: (1) first-person experience signals, (2) verifiable credentials and publications, (3) social proof elements, (4) Person schema markup, and (5) recommendations for a dedicated author page that satisfies Google's E-E-A-T guidelines...
contente-e-a-tauthor
GEO v1.0

Entity Salience Prominence Optimizer

Improves entity salience and prominence signals on a page so LLMs associate it with target topics.

Analyze the content of {url} and score its entity salience for the topic {target_topic}. Identify: (1) entities that should appear but are missing, (2) entities present but mentioned too infrequently, (3) co-occurrence patterns with authoritative entities in the space. Rewrite the introduction and key body sections to improve entity prominence...
geoentitysalience
Audit v1.0

Internal Link Depth Distribution

Evaluates click depth distribution of internal links to surface pages buried too deep for crawlers.

Using the crawl data for {domain}, calculate the click depth of every indexed URL from the homepage. Flag any URLs beyond {max_depth} clicks deep, group them by page template, and recommend internal linking changes to bring priority pages within {target_depth} clicks...
auditinternal-linkscrawl-budget
GEO v1.0

LLM Source Drift Topic Audit

Tracks how LLM source preferences shift across topic clusters over time to flag brand citation losses.

Over the following time periods {period_list}, re-run the query set {query_list} on {llm_platform} and record which sources are cited each time for {brand_domain}'s topic cluster. Flag any queries where {brand_domain} was previously cited but is no longer, and hypothesize the drift cause...
geollmdrift
Ranking v1.0

Local Pack Citation Signal Gap

Identifies NAP inconsistencies and missing local citations causing underperformance in the local pack.

Audit the local citation profile for {business_name} in {location}. Compare NAP data across: Google Business Profile, Bing Places, Yelp, Apple Maps, and top {niche} directories. Flag any inconsistencies, missing listings, or duplicate listings. Output a citation correction and acquisition priority plan...
rankinglocal-packcitations
GEO v1.0

Multi-LLM Citation Coverage Tester

Tests whether {brand_domain} is cited across ChatGPT, Claude, Perplexity, and Gemini for key queries.

For each query in {query_list}, submit it to ChatGPT, Claude, Perplexity, and Gemini. Record whether {brand_domain} is cited, the citation position, and the surrounding context. Produce a citation coverage matrix and identify which LLM has the largest citation gap for this brand...
geomulti-llmcitation
Ranking v1.0

SERP Intent Shift Classifier

Classifies whether SERP intent for a keyword set has shifted and flags pages that no longer match intent.

For each keyword in {keyword_list}, analyze the current top-10 SERP results and classify the dominant intent (informational, navigational, commercial, transactional). Compare against the intent classification recorded at {prior_date}. Flag any intent shifts and list the pages on {domain} that are now misaligned...
rankingintentserp
Ranking v1.0

SERP Volatility Winner Loser Map

Maps which domains win and lose rankings during high-volatility periods for a target keyword set.

Using ranking history data for {keyword_list} over the period {date_range}, identify: (1) which domains consistently gained positions during volatility events, (2) which domains lost positions, (3) the page types and content patterns of winners, and (4) what changes {domain} should make to align with winning patterns...
rankingvolatilitycompetitor
Audit v1.0

Technical Site Log Signal Audit

Analyzes server log files to surface crawl frequency, bot behavior, and missed indexing signals.

Review the following server log data for {domain} and identify: (1) Googlebot crawl frequency by URL segment, (2) URLs crawled but not indexed, (3) high-frequency 404s, and (4) crawl budget waste patterns. Output a prioritized fix table...
auditlog-filecrawl
Content v1.0

Topic Cluster Hub Page Spec

Designs a hub page specification for a topic cluster including spoke page coverage and internal link anchors.

Design a hub page specification for the topic cluster '{cluster_topic}' on {domain}. Define: (1) the hub page URL and title, (2) the full list of spoke pages with target keywords, (3) recommended internal link anchor texts from hub to spokes and vice versa, and (4) the content depth required at the hub level to establish topical authority...
contenttopic-clusterinternal-links
Audit v1.0

Canonical Chain Loop Finder

Detects canonical chains and self-referential loops that dilute crawl and indexing signals.

Given the canonical tag data export for {site}, identify all instances of: (1) canonical chains where Page A canonicals to Page B which canonicals to Page C, and (2) pages that canonical to a URL that returns a non-200 status. Output a table with chain URLs, hop count, final target status, and recommended canonical correction...
auditcanonicalindexing
Ranking v1.0

Cluster Opportunity Sizing Plan

Estimates the traffic opportunity of each topic cluster before committing content resources.

For the site {domain} in the {industry} vertical, evaluate the following proposed topic clusters: {cluster_list}. For each cluster, estimate: total addressable search volume, current {domain} coverage percentage, top competitor coverage, and estimated 12-month traffic gain if the cluster is fully built out. Output a ranked investment priority table with cluster, TAM, current gap, and effort estimate...
rankingtopic-clustersopportunity
Content v1.0

Content Gap Cluster Topic Finder

Identifies uncovered subtopic clusters within an existing content strategy.

Analyze the existing content inventory for {domain} in the topic area {topic_area} and compare against the full topic universe covered by top-ranking competitors {competitor_list}. Identify subtopic clusters with zero or thin coverage on {domain} that competitors have fully built out. Output a gap map grouped by cluster with estimated traffic opportunity and recommended content type for each gap...
contentcontent-gaptopic-clusters
Content v1.0

Content Refresh Traffic Priority Brief

Scores and ranks existing content pages for refresh ROI based on traffic decay signals.

Analyze the content performance data for {domain} and identify pages that have experienced organic traffic decline of more than {decline_threshold}% over the past {time_period}. For each declining page, score refresh priority based on: current ranking position, traffic loss rate, backlink equity, and commercial intent. Output a ranked refresh brief with specific update actions for each priority page...
contentcontent-refreshtraffic-decay
Audit v1.0

CWV Field Data Segment Audit

Segments CrUX Core Web Vitals data by device and page group to isolate failing cohorts.

Analyze the CrUX field data extract for {site} and segment INP, LCP, and CLS scores by device type (mobile/desktop) and page template. Identify which template-device combinations are failing Good thresholds, estimate the percentage of sessions impacted, and output a ranked fix priority list...
auditcore-web-vitalscrux
GEO v1.0

Entity Salience Topic Map

Maps entity salience scores across topic areas to strengthen LLM brand association.

Using the content corpus for {brand_domain}, map entity salience for {brand} across the topic areas {topic_list}. For each topic, score the prominence of the brand entity relative to competing entities, identify where salience is lowest, and recommend on-page and off-page actions to increase entity prominence in LLM training-relevant content...
geoentity-saliencetopical-authority
Audit v1.0

JS Render Content Delta Check

Compares raw HTML vs rendered DOM to surface content hidden from Googlebot.

Compare the raw HTML source and the fully rendered DOM for the following URLs on {site}. Identify all content present in the rendered DOM but absent from the raw HTML, including navigation links, body text, structured data, and canonical tags. Output a delta table with element type, content preview, SEO impact severity, and fix recommendation...
auditjavascriptrendering
GEO v1.0

LLM Recency Content Gap Brief

Identifies content freshness gaps preventing a brand from appearing in LLM recency-sensitive answers.

Analyze the content publication and update history for {brand_domain} against competitor sources that are being cited by LLMs for recency-sensitive queries in {topic_area}. Identify which content assets are stale, what freshness signals competitors have that {brand_domain} lacks, and produce a refresh brief ordered by estimated citation impact...
georecencycontent-freshness
Ranking v1.0

Local Pack Citation Gap Plan

Identifies NAP citation inconsistencies and gaps suppressing local pack rankings.

Audit the local citation profile for {business_name} in {location} against the top three local pack competitors for {target_keyword}. Identify NAP inconsistencies, missing directory listings, review count gaps, and category mismatches. Output a prioritized citation fix and acquisition plan with estimated local pack ranking impact for each action...
rankinglocal-packcitations
Audit v1.0

Orphan Page Path Finder

Detects pages with zero internal links and maps nearest linking opportunities.

Given the crawl export for {site}, identify all pages receiving zero internal links. For each orphan page, suggest the three most contextually relevant existing pages that could link to it, propose anchor text, and estimate the crawl depth improvement if the link were added...
auditinternal-linkscrawl
Content v1.0

Programmatic Content Schema Brief

Creates a scalable content and schema template spec for programmatic page generation.

Design a programmatic content template for {page_type} pages on {domain} targeting the pattern {url_pattern}. The template must specify: dynamic content variables, static content requirements for E-E-A-T, required schema markup type and properties, internal linking logic, and minimum content thresholds to avoid thin content penalties. Output the full template spec with an example populated instance...
contentprogrammaticschema
Technical v1.0

Schema Markup JSON-LD Repair Brief

Diagnoses JSON-LD validation errors and outputs corrected schema markup for each affected page.

Review the following JSON-LD schema validation errors from Google Search Console and the Schema.org validator for {domain}: {error_list}. For each error, identify the root cause (missing required property, incorrect value type, wrong @type, nested entity error), output the corrected JSON-LD snippet, and provide the implementation instruction for the developer...
technicalschemajson-ld
GEO v1.0

Brand Mention Co-occurrence Mapper

Maps which entities and topics co-occur with a brand in LLM-cited sources to reveal association gaps.

Scrape or review the top 30 third-party pages that mention {brand_name} and identify all entity co-occurrences (people, places, topics, competing brands). Map which associations are strong vs. absent compared to the desired topical positioning of {brand_name} in {target_market}. Output an association gap plan...
geobrand-mentionsentity
Ranking v1.0

Branded SERP Feature Ownership Audit

Audits which SERP features a brand owns or loses on its own branded queries and prescribes ownership actions.

Search for the following branded queries for {brand_name}: {branded_query_list}. For each SERP, record which features appear (sitelinks, Knowledge Panel, PAA, featured snippets, image packs) and whether {site_url} controls them. Flag losses and prescribe structured data or content actions to reclaim each feature...
rankingbranded-serpserp-features
GEO v1.0

Claude Topical Citation Pattern Audit

Analyzes Claude's citation source preferences for a specific topic to reverse-engineer inclusion criteria.

Submit the following {query_list} to Claude and record all cited or referenced sources. Analyze cited sources for common attributes: content depth, recency, author credentials, domain type, and structural formatting. Output a pattern report and a content adaptation brief for {site_url}...
geoclaudecitation
Content v1.0

Content Brief Search Intent Mapper

Builds a content brief with SERP-validated intent signals, content format, and depth requirements for a target query.

Create a detailed content brief for the target query '{target_query}' based on analysis of the top 10 SERP results. Include: confirmed intent type, recommended content format, required H2/H3 structure, must-cover subtopics, word count range, and E-E-A-T signals needed. Output as a structured brief template...
contentbriefintent
Content v1.0

Content Outline Competitor Depth Gap

Builds a content outline that surpasses competitor depth on subtopics where the target site currently underperforms.

Analyze the top 5 ranking pages for '{target_keyword}' and extract their H2/H3 outlines. Compare subtopic coverage depth against the existing {site_url} page. Build an enhanced outline that covers all competitor subtopics plus {n} additional subtopics competitors miss. Flag each section with recommended word count and evidence type...
contentoutlinecompetitor-analysis
Audit v1.0

Core Web Vitals CrUX Template Triage

Segments CrUX field data by page template to pinpoint which site sections fail Core Web Vitals thresholds.

Given the CrUX API data for {site_url}, segment LCP, INP, and CLS scores by page template. Flag all templates in the 'needs improvement' or 'poor' range, identify the most impactful template to fix first by traffic weight, and output a fix priority matrix...
auditcore-web-vitalscrux
Content v1.0

E-E-A-T Signal Content Enricher

Rewrites or enriches existing content with specific E-E-A-T signals missing from the page per Google's QRG.

Review the content at {page_url} targeting the query '{target_query}'. Identify which E-E-A-T signals are absent or weak: first-hand experience markers, author credentials, sourced statistics, expert quotes, and trust signals. Rewrite the introduction and key sections to inject these signals naturally...
contente-e-a-tquality
GEO v1.0

Generative SERP Content Fit Audit

Audits whether existing content is structurally fit for inclusion in generative SERP features like AI Overviews.

Review the content on {page_url} targeting {target_query}. Assess fitness for generative SERP inclusion by evaluating: paragraph answer completeness, use of definition patterns, numerical fact density, and authoritative attribution. Output a rewrite brief prioritizing the highest-impact changes...
geogenerative-serpcontent-fit
Content v1.0

FAQ Entity Schema Content Expander

Generates FAQ sections with embedded entity mentions and FAQPage schema markup for a target topic page.

For the page targeting '{target_topic}' at {page_url}, generate a 6-question FAQ section. Each question must: address a confirmed PAA query, embed a relevant named entity, and be answerable in under 60 words. Output FAQ content in plain text and the corresponding FAQPage JSON-LD schema block...
contentfaqschema
GEO v1.0

GEO Topical Coverage Gap Brief

Identifies topical sub-questions a site fails to answer that LLMs consistently cite competitors to address.

For the topic {main_topic}, submit 20 related queries to {llm_tool} and record which sub-questions result in competitor citations rather than {site_url}. Group uncovered sub-questions by theme and output a prioritized GEO content brief to close the topical coverage gaps...
geotopical-authoritycontent-gap
Audit v1.0

Image SEO Alt Text Coverage Audit

Audits image alt text presence, relevance, and keyword alignment across priority page templates.

Review the image inventory export for {site_url} covering pages in {page_templates}. Identify images missing alt text, images with generic alt text (e.g., 'image', 'photo'), and images where alt text misaligns with surrounding content. Output a tiered remediation list...
auditimage-seoaccessibility
Technical v1.0

INP Interaction Event Tracer

Diagnoses the highest INP-contributing interaction events on a page and traces them to JavaScript execution sources.

Using the Chrome DevTools Performance panel data for {page_url}, identify the top 3 interactions contributing most to INP. For each interaction, trace: input delay source, processing time by JS function, and presentation delay cause. Output a fix spec per interaction including code-level optimization recommendations...
technicalinpcore-web-vitals
Audit v1.0

Internal Link Distribution Audit

Scores internal link equity distribution across page templates and highlights imbalances harming priority pages.

Using the internal link graph export for {site_url}, calculate inlink counts per URL, segment by page template ({template_types}), and identify the top 20 priority pages receiving fewer than {min_inlinks} internal links. Recommend redistribution actions...
auditinternal-linksequity
Technical v1.0

LCP Element Load Chain Optimizer

Traces the full resource load chain for the LCP element and prescribes specific fixes to reduce LCP time.

Analyze the WebPageTest or Chrome DevTools waterfall for {page_url}. Identify the LCP element, trace its full resource load chain (preload scanner, render-blocking resources, third-party delays), and calculate the contribution of each chain link to total LCP time. Output a prioritized fix list with expected LCP improvement per fix...
technicallcpcore-web-vitals
GEO v1.0

LLM Source Authority Gap Brief

Identifies authority signal gaps preventing a site from being selected as an LLM training or retrieval source.

Analyze the authority signals of {site_url} vs. the top 10 sources cited by LLMs for the topic {topic_cluster}. Compare: domain age, backlink profile depth, author entity signals, E-E-A-T markers, and content freshness. Output a prioritized authority gap brief...
geoauthorityllm
Ranking v1.0

Local Pack Ranking Signal Gap

Compares GBP and local signals of a business against top local pack competitors to identify ranking gaps.

Analyze the Google Business Profile and local citation signals for {business_name} in {location} for the query '{target_query}'. Compare against the top 3 local pack ranking businesses. Identify gaps in: review velocity, category accuracy, citation consistency, and GBP completeness. Output a ranked fix list...
rankinglocal-seogbp
Audit v1.0

Log File Bot Crawl Frequency Scorer

Parses server log data to score Googlebot crawl frequency patterns and surface crawl waste signals.

Given the server log extract below for {site_url}, calculate Googlebot crawl frequency per URL template, identify over-crawled low-value paths, and under-crawled high-value sections. Output a prioritized action table...
auditlog-filecrawl
GEO v1.0

Multi-LLM Citation Consistency Audit

Tests citation of {brand_name} across ChatGPT, Claude, Perplexity, and Gemini to identify consistency gaps.

Submit the query '{target_query}' to ChatGPT, Claude, Perplexity, and Gemini. Record whether {brand_name} is cited, its citation rank, surrounding context, and source URLs referenced. Output a consistency matrix and recommend which LLM to prioritize for citation improvement efforts...
geomulti-llmcitation
Audit v1.0

Schema Type Gap Identifier

Compares implemented schema types against competitor markup to surface missing structured data opportunities.

Review the following list of schema types implemented on {site_url} and compare against the schema types found on {competitor_urls}. Identify gaps, prioritize by rich-result eligibility, and output a remediation roadmap...
auditschemarich-results
Technical v1.0

Sitemap Index Priority Architecture

Designs a sitemap index structure that logically segments URL sets by type and maximizes crawl prioritization.

Design a sitemap index architecture for {site_url} with an estimated {total_url_count} indexable URLs across templates: {template_list}. Define how to split URLs into child sitemaps by template, set lastmod update frequency per type, and specify which sitemaps to submit first in Search Console. Output as a full sitemap index XML spec...
technicalsitemaparchitecture
Content v1.0

Title Tag Intent Alignment Rewriter

Rewrites title tags to align with confirmed SERP intent, improve CTR, and fit within pixel width limits.

Rewrite the following {n} title tags for pages on {site_url}. For each, confirm the dominant SERP intent for the target keyword, ensure the title matches that intent, includes a power word, fits within 580 pixels (~60 characters), and has a distinct value proposition. Output original vs. revised title pairs with rationale...
contenttitle-tagsctr
GEO v1.0

AI Overview Passage Depth Mapper

Maps which content passage depths and formats are most frequently cited in AI Overviews for a topic.

For the query set {query_list}, trigger AI Overviews and record which passages are cited. Analyze citation depth (intro, body, conclusion), content format (list, paragraph, table), and source domain authority. Output a passage-format preference model...
geoai-overviewpassage-retrieval
GEO v1.0

ChatGPT Source Preference Model

Models which domain and content signals ChatGPT Browse prefers when selecting sources for a topic.

Using ChatGPT with Browse enabled, submit {query_list} and record every cited URL, domain, content type, and publication date. Model the shared signals (domain authority, content format, word count, freshness) and output a content specification to match ChatGPT's source preferences for {topic}...
geochatgptsource-authority
GEO v1.0

Claude Entity Citation Readiness Audit

Evaluates whether your content's entity signals meet Claude's citation selection criteria for a topic.

Submit {query_list} to Claude and record cited sources. Extract entity density, citation context length, and structural signals (headers, bullets, definitions) from cited pages. Compare against {your_url} and produce a gap remediation checklist to improve Claude citation likelihood...
geoclaudeentity
Ranking v1.0

Competitor Content Gap Rank Opportunity

Finds keywords where competitors rank in top 10 but your site has no page, sorted by opportunity score.

Compare the organic keyword profile of {competitor_domain} against {your_domain} using this keyword export {keyword_gap_csv}. Identify keywords where {competitor_domain} ranks positions 1-10 and {your_domain} is unranked or beyond position 20. Sort by monthly search volume × difficulty inverse score and output the top 30 gap opportunities...
rankingcompetitor-gapkeywords
Content v1.0

Content Decay Page Priority Matrix

Scores decaying pages by traffic loss, ranking drop, and refresh effort to prioritize content updates.

Using this GSC performance export {gsc_export_csv} and this ranking history {rank_history_csv}, identify pages with declining clicks and impressions over the past {time_period}. Score each by: traffic loss severity, current ranking position, content age, and estimated refresh effort. Output a prioritized refresh matrix...
contentcontent-decayprioritization
Content v1.0

Content Outline Authority Signal Builder

Builds a content outline that embeds E-E-A-T authority signals at each section level.

Create a detailed content outline for an article targeting {target_keyword}. For each H2 and H3 section, specify: the subtopic to cover, the authority signal to embed (first-person experience, cited statistic, expert quote, original data), the recommended word count, and the target entity to mention...
contente-e-a-toutline
Audit v1.0

CrUX Template CWV Breakdown Audit

Breaks down Core Web Vitals CrUX data by page template to prioritize performance fixes.

Using this CrUX dataset {crux_data} segmented by URL pattern, group pages into template categories and surface which templates have the highest proportion of URLs failing LCP, CLS, or INP thresholds. Output a prioritized fix table...
auditcore-web-vitalscrux
Content v1.0

FAQ Intent Question Block Generator

Generates intent-mapped FAQ blocks with FAQPage schema for a target page and keyword cluster.

Generate 10 FAQ questions and answers for a page targeting {primary_keyword} on {site_url}. Map each question to a distinct searcher intent (informational, navigational, commercial, transactional). Format answers in 40-60 words each, optimized for PAA capture and FAQPage schema. Include the full JSON-LD FAQPage markup block...
contentfaqschema
Ranking v1.0

Featured Snippet Format Gap Auditor

Audits current snippet-winning formats for a keyword set and identifies format mismatches on your pages.

For each keyword in {keyword_list}, record the current featured snippet format (paragraph, list, table, video). Compare to the content format used on {your_url} for the same query. Flag all format mismatches and recommend HTML restructuring to align with the winning snippet format...
rankingfeatured-snippetserp
GEO v1.0

Generative SERP Format Targeting Brief

Identifies which content formats trigger generative SERP features for a target query set.

For each query in {query_list}, document which generative SERP features appear (AI Overview, Perplexity answer card, SGE carousel). Classify the content format of cited sources (how-to, listicle, comparison table, definition). Produce a format-targeting brief for {site_url} to maximize generative feature inclusion...
geogenerative-serpformat
Technical v1.0

INP Interaction Trace Root Cause Spec

Diagnoses INP failures using interaction trace data and produces a prioritized JavaScript fix plan.

Analyze this Chrome DevTools performance trace {trace_data} captured on {url}. Identify all interactions with INP > 200ms. For each, pinpoint the longest task, the responsible JavaScript function, event handler blocking time, and main-thread yield opportunities. Output a prioritized code-level fix plan...
technicalinpcore-web-vitals
Content v1.0

Internal Link Anchor Text Gap Plan

Identifies anchor text diversity gaps in internal linking and recommends optimized anchor variations.

Audit all internal links pointing to {target_url} using this crawl export {crawl_csv}. Classify each anchor as: exact-match, partial-match, branded, naked URL, or generic. Flag over-optimization or under-optimization patterns and recommend a diversified anchor text plan aligned to {target_keyword} and its semantic variants...
contentinternal-linksanchor-text
Audit v1.0

Internal Link Depth Distribution Scorer

Maps click-depth distribution of all indexed URLs to find pages buried too deep for efficient crawl.

Given this crawl graph export {crawl_graph_csv} for {site_url}, calculate the click depth from the homepage for every URL. Produce a histogram of depth distribution and flag all URLs with depth > {max_depth} that have organic impressions above {impression_threshold}...
auditinternal-linkscrawl-budget
Audit v1.0

JS Rendered Content Delta Checker

Compares raw HTML vs. JavaScript-rendered DOM to identify SEO-critical content visible only post-render.

Compare the raw HTML source {raw_html} against the fully JavaScript-rendered DOM {rendered_html} for {url}. List all headings, body text, links, and structured data present only in the rendered version, and assess the indexing risk for each...
auditjavascriptrendering
Technical v1.0

JSON-LD Organization Identity Builder

Generates a complete Organization JSON-LD block with identity signals to support knowledge panel eligibility.

Generate a complete Organization schema JSON-LD block for {brand_name} using the following details: {brand_info}. Include: @type, name, url, logo, sameAs (all social and authoritative profiles), contactPoint, address, and foundingDate. Validate all sameAs URIs against Wikidata and schema.org standards...
technicalschemajson-ld
GEO v1.0

LLM Recency Bias Content Plan

Diagnoses how LLM training-data recency affects citation likelihood and builds a freshness content plan.

Analyze citation timestamps from Perplexity and AI Overview results for the topic {topic}. Identify the recency window most commonly cited (e.g., last 6 months), flag your content that falls outside that window, and recommend an update schedule to maintain citation eligibility...
georecencyfreshness
Ranking v1.0

People Also Ask Intent Gap Expander

Mines PAA boxes for a seed keyword to uncover intent gaps and cluster them into content opportunities.

Collect up to 50 PAA questions triggered by {seed_keyword} by recursively expanding the PAA box. Cluster questions by searcher intent (informational, navigational, transactional, commercial). Map each cluster to existing {site_url} content and flag intent gaps with no current page...
rankingpaaintent
GEO v1.0

Perplexity Citation Source Profiler

Profiles which domains Perplexity consistently cites for a topic cluster and models their shared signals.

Run the following queries {query_list} in Perplexity and record every cited source URL and domain. Identify the top 10 cited domains, their common content traits (format, depth, recency, author credentials), and produce a citation signal profile to replicate...
geoperplexitycitation
Content v1.0

Programmatic Content Quality Template

Designs a programmatic content template that passes quality thresholds and avoids thin-content penalties.

Design a programmatic content template for {page_type} pages targeting {keyword_pattern} at scale. Specify required dynamic content blocks, minimum unique content percentage per page, entity injection rules, schema implementation, and internal linking patterns. Include quality-gate criteria to exclude pages below {quality_threshold}...
contentprogrammatictemplate
Audit v1.0

Redirect Loop Impact Finder

Detects redirect loops and multi-hop chains and scores their crawl-equity impact.

Given this crawl export {crawl_csv}, identify all redirect loops (A→B→A) and chains exceeding 2 hops. For each, report the final destination URL, chain depth, estimated PageRank dilution, and recommended consolidation action...
auditredirectscrawl
Content v1.0

Schema-Rich Comparison Article Drafter

Drafts a comparison article with embedded schema markup optimized for featured snippets and AI citation.

Write a {word_count}-word comparison article for {topic} comparing {option_a} vs. {option_b}. Structure the content with a definition intro, comparison table (Table schema), FAQ section (FAQPage schema), and a verdict section. Ensure each section addresses a distinct PAA question from the SERP...
contentschemacomparison
Ranking v1.0

SERP Volatility Winner Loser Analysis

Analyzes SERP rank-tracking data during a volatility event to classify winners, losers, and causes.

Given this rank-tracking export {rank_data_csv} spanning the volatility window {date_range}, identify URLs that gained or lost more than {threshold} positions. Cluster winners and losers by content type, domain authority, and on-page signals to hypothesize update impact causes...
rankingvolatilityalgorithm
Content v1.0

Title Tag Click Intent Optimizer

Rewrites title tags by aligning search intent, power words, and pixel length for maximum CTR.

Rewrite the following title tags {title_tag_list} for pages on {site_url}. For each, identify the dominant search intent from the target keyword, apply a power word, include the primary keyword within the first 30 characters, and keep total length under 60 characters. Output old vs. new title with rationale...
contenttitle-tagsctr
GEO v1.0

AI Mode SERP Content Gap Plan

Builds a content gap plan targeting queries where AI Mode is displacing organic rankings.

For {site_url}, analyze the following queries where AI Mode features are appearing in SERPs: {query_list}. For each query, identify what content type, format, and entity depth AI Mode is surfacing. Output a content gap plan for {brand_name} to increase AI Mode source likelihood...
geoai-modecontent-gap
Audit v1.0

Canonical Self-Ref Conflict Sweep

Detects canonical tags that point to non-canonical, redirected, or conflicting URLs.

Review the canonical tag data for {site_url}: {canonical_export_csv}. Identify all cases where the canonical URL: (a) is not self-referencing on a preferred page, (b) points to a redirected URL, (c) conflicts with the HTTP header canonical, or (d) is missing entirely. Output a fix table with priority score...
auditcanonicalduplicate-content
GEO v1.0

ChatGPT Entity Salience Brief

Maps which entities must be prominent in content for ChatGPT to associate the brand with a topic.

For the topic '{target_topic}', analyze ChatGPT's responses to the following 10 queries: {query_list}. Identify which entities, concepts, and sources appear most frequently in ChatGPT's outputs. Create an entity salience brief for {brand_name} to incorporate into its content strategy...
geochatgptentity-salience
GEO v1.0

Claude Citation Readiness Audit

Assesses whether a page meets Claude's apparent content quality signals for citation selection.

Review the following page content from {page_url} against Claude's known citation preference signals: source authority, factual specificity, recency, structured formatting, and entity prominence. Score each signal and output a gap report with concrete content improvements...
geoclaudecitation-readiness
Ranking v1.0

Competitor SERP Share Gap Model

Models SERP share of voice gaps between your site and top competitors by topic cluster.

Using the following SERP visibility data for {site_url} and competitors {competitor_list} across keyword cluster '{cluster_name}': {visibility_data}. Calculate share of voice per domain, identify clusters where {site_url} is under-indexing versus competitors, and output a gap model with opportunity sizing by cluster...
rankingcompetitorshare-of-voice
Content v1.0

Content Brief Intent Depth Builder

Generates a full content brief with intent layers, entity requirements, and format spec.

Create a comprehensive content brief for the target keyword '{target_keyword}' for {site_url}. Include: primary and secondary intent analysis, required entities and their prominence levels, recommended content format, suggested word count range, schema markup recommendation, internal link targets, and E-E-A-T signal requirements...
contentbriefintent
Content v1.0

Content Outline Entity Signal Map

Builds a content outline that maps required entities to each section for topical authority.

For the topic '{target_topic}', generate a detailed content outline for {site_url}. For each H2 and H3 section, specify: the primary entity to feature, supporting entities to reference, the intent micro-moment addressed, recommended content format (prose/list/table/visual), and suggested internal link anchor text...
contentoutlineentity
Content v1.0

Content Refresh Decay Signal Audit

Diagnoses traffic decay causes for underperforming content and prescribes targeted refresh actions.

Analyze the following underperforming content pages on {site_url}: {page_data_csv} (includes URL, traffic trend, rankings, last updated date). For each page, diagnose the primary decay signal: freshness, intent drift, entity gap, link decay, or competitor content improvement. Output a refresh action plan per page with effort/impact score...
contentcontent-decayrefresh
Audit v1.0

Faceted Nav Index Bloat Audit

Identifies which faceted URL combinations are wasting crawl budget through unnecessary indexing.

Given the faceted navigation URL patterns for {site_url} and their crawl/index status data, classify each facet combination as: index-worthy, noindex-recommended, or disallow-recommended. Base decisions on search volume, uniqueness of content, and crawl frequency data...
auditfaceted-navcrawl-budget
Audit v1.0

Core Web Vitals CrUX Breakdown

Diagnoses CrUX field data failures by device and origin segment for a given site.

Analyze the CrUX field data below for {site_url}, segmented by mobile and desktop. For each metric (LCP, INP, CLS) flagged as 'Needs Improvement' or 'Poor', identify the most likely contributing page templates and suggest root-cause hypotheses ranked by probable impact...
auditcore-web-vitalscrux
Content v1.0

FAQ Intent Cluster Content Block

Generates a schema-ready FAQ block clustered by user intent stage for a target topic.

For the target topic '{target_topic}' on {site_url}, generate 15 FAQ questions and answers clustered by intent stage: awareness (5), consideration (5), and decision (5). Each answer should be 40–80 words, directly answer the question, and be formatted for FAQPage schema markup. Include the full JSON-LD block at the end...
contentfaqschema
Audit v1.0

Image SEO Alt Structured Data Audit

Audits image alt text quality and structured data eligibility across key page templates.

Audit the following image inventory from {site_url}: {image_data_csv}. For each image, evaluate: alt text presence, alt text descriptiveness (score 1-5), file name SEO relevance, and whether the page qualifies for ImageObject structured data. Output a prioritized fix list...
auditimage-seostructured-data
Technical v1.0

LCP Resource Chain Diagnostic

Traces the full LCP resource load chain to identify the blocking step causing poor LCP scores.

Analyze the LCP diagnostic data for {page_url}: {lcp_trace_data}. Trace the full resource load chain for the LCP element: initial request, server response time, render-blocking resources, resource discovery delay, and load delay. Identify the single highest-impact bottleneck and output a specific technical fix with implementation code...
technicallcpcore-web-vitals
Ranking v1.0

Local Pack Citation Gap Map

Maps NAP citation inconsistencies blocking local pack ranking for a given business.

For {business_name} targeting local pack rankings in {target_location}, analyze the following NAP citation data across directories: {citation_csv}. Flag inconsistencies in Name, Address, and Phone format. Identify the top citation sources where {business_name} is missing or has conflicting data, and output a fix priority list...
rankinglocal-packcitations
Audit v1.0

Log File Segment Comparison

Compares Googlebot crawl behavior across two time periods using log file data.

Analyze the following two log file exports for {site_url} — Period A: {period_a_dates} and Period B: {period_b_dates}. Compare Googlebot crawl frequency, crawl distribution by template type, and any URLs gaining or losing crawl attention. Highlight anomalies and hypothesize causes...
auditlog-filegooglebot
GEO v1.0

Multi-LLM Query Coverage Matrix

Tests a set of queries across multiple LLMs and maps brand citation presence per model.

For the following 10 queries relevant to {brand_name}: {query_list}, document the response and citation sources from ChatGPT, Claude, Perplexity, and Gemini. Build a matrix showing: which LLMs cite {brand_domain}, which competitors appear, and which queries have zero brand coverage...
geomulti-llmcitation-coverage
Audit v1.0

Orphan Page Link Equity Gap

Identifies orphan pages that have backlinks but no internal links, flagging equity loss.

Given this list of orphaned pages (no internal links) for {site_url} and their respective backlink counts, identify which orphan pages are losing the most link equity. Suggest the three most logical internal link placements for each high-value orphan page...
auditorphan-pageslink-equity
Ranking v1.0

PAA Question Intent Matrix

Extracts and classifies PAA questions by intent stage to fuel content and FAQ strategy.

For the seed topic '{seed_topic}', compile all People Also Ask questions appearing across the top 20 SERP results. Classify each question by intent stage (awareness, consideration, decision, retention) and content format best suited to answer it. Output a prioritized PAA intent matrix for {site_url}...
rankingpaaintent
Technical v1.0

Schema Markup Type Gap Generator

Identifies missing schema markup types across page templates and generates implementation specs.

Audit the schema markup coverage for {site_url} by page template type: {template_list}. For each template, identify which Schema.org types are present, which are missing but applicable, and which are partially implemented. Output a gap table with the recommended JSON-LD snippet structure for each missing schema type...
technicalschemastructured-data
GEO v1.0

Source Authority Signal Stack

Builds a ranked stack of authority signals a domain must demonstrate for LLM source selection.

Analyze the following competing domains that are consistently cited by LLMs for '{target_topic}': {competitor_domains}. Reverse-engineer the authority signal stack they share (backlink profiles, content depth, entity coverage, structured data, author signals). Output a ranked signal stack and gap analysis for {brand_domain}...
geosource-authoritycompetitive
Audit v1.0

Technical Site Crawl Diagnostic

Generates a structured crawl diagnostic checklist for identifying critical technical SEO issues.

You are a technical SEO auditor. Given the crawl data for {site_url}, identify all critical issues across crawl depth, status codes, response times, and page types. Output a prioritized issue table with severity, affected URL count, and recommended fix for each issue...
auditcrawltechnical
Content v1.0

Title Meta SERP CTR Rewrite Batch

Rewrites title tags and meta descriptions for a URL batch to maximize SERP CTR.

Rewrite the title tags and meta descriptions for the following pages on {site_url}: {page_data_csv} (includes URL, current title, current meta, target keyword, avg. CTR). For each page, output 3 title tag variants and 2 meta description variants optimized for click-through using emotional triggers, numbers, brackets, and power words where appropriate...
contenttitle-tagsctr
Content v1.0

Topic Cluster Gap Opportunity Map

Identifies content gaps within an existing topic cluster and sizes the ranking opportunity.

Analyze the existing content cluster for '{cluster_topic}' on {site_url}: {existing_content_list}. Compare against the full topic universe by auditing competitor content and SERP coverage. Identify missing subtopics, estimate search volume opportunity for each gap, and output a prioritized gap map with recommended content types...
contenttopic-clustergap-analysis
Technical v1.0

XML Sitemap Split Index Engineer

Designs a split sitemap index architecture for large sites with multiple content type categories.

Design a sitemap index architecture for {site_url} with {total_url_count} indexable URLs across content types: {content_type_list}. Specify how to split sitemaps by content type and priority tier, maximum URL counts per file, update frequency recommendations per sitemap, and the sitemap index XML structure. Output all XML files...
technicalsitemaparchitecture
GEO v1.0

AEO Topical Authority Gap Map

Maps topical authority gaps preventing a site from ranking in AEO and GEO placements.

For the topic cluster {topic_cluster}, compare the topical depth of {your_domain} against the top 3 AEO/GEO-visible domains: {competitor_domains}. Identify subtopics where your coverage is absent or shallow, and output a prioritized content creation roadmap to close authority gaps...
geoaeotopical-authority
GEO v1.0

ChatGPT Entity Citation Readiness Plan

Assesses whether your brand entity is structured for ChatGPT citation in Browse mode.

Evaluate the following brand entity signals for {brand}: website: {url}, Wikipedia presence: {wiki_status}, Wikidata entry: {wikidata_status}, press mentions: {press_count}. Score the entity's readiness for ChatGPT Browse-mode citation and output a gap-closure action plan...
geochatgptentity
Content v1.0

FAQ Block Schema Content Drafter

Drafts FAQ content blocks with embedded FAQPage schema for rich result eligibility.

Draft 8 FAQ question-answer pairs for the page targeting {target_keyword} on {your_domain}. Each answer should be 40-60 words, directly address the question, and avoid promotional language. Output the content in both plain text and FAQPage JSON-LD schema format for immediate implementation...
contentfaqschema
Audit v1.0

Core Web Vitals CrUX Triage

Triages CrUX field data by page group to prioritize CWV improvement efforts.

You are given CrUX field data for {domain} segmented by page type: {crux_data}. For each page group failing Core Web Vitals thresholds, identify the most likely root cause, prioritize fixes by traffic-weighted impact, and suggest a remediation owner (dev, design, or content)...
auditcore-web-vitalscrux
Ranking v1.0

Image SERP Structured Data Gap Audit

Identifies structured data and metadata gaps preventing image SERP feature eligibility.

Audit the images on {your_url} for image SERP ranking factors: alt text specificity, filename conventions, surrounding text relevance, page topic alignment, and structured data (ImageObject, Product, Recipe schema). Output a gap report with specific fixes for each image...
rankingimage-serpstructured-data
Audit v1.0

Log File Segment Analyzer

Breaks down server log data by bot segment to surface crawl inefficiencies.

Analyze the following server log data for {domain}: {log_sample}. Segment requests by Googlebot, Bingbot, and other crawlers. Identify pages over-crawled, pages under-crawled, and crawl waste by URL pattern...
auditlog-filecrawl
Ranking v1.0

PAA Question Intent Map

Extracts and maps People Also Ask questions to intent stages for content integration.

Extract all People Also Ask questions for the seed query {seed_query} across 3 SERP depth levels. Classify each question by intent stage (awareness, consideration, decision) and buyer persona, then map them to existing {your_domain} content gaps for FAQ and H2 integration...
rankingpaacontent-gap
Content v1.0

Programmatic SEO Template Content Brief

Designs a programmatic content template brief for scalable, SEO-optimized page generation.

Design a programmatic content template for {page_type} pages on {your_domain}, targeting the keyword pattern {keyword_pattern}. Specify: required dynamic fields, static content blocks, internal link rules, schema type, unique value-add data source, and thin-content safeguards...
contentprogrammatic-seotemplate
Technical v1.0

Redirect 301 Strategy Spec

Produces a server-specific 301 redirect implementation spec for a site migration.

Create a 301 redirect strategy spec for the migration of {old_domain} to {new_domain}. Given the URL mapping: {url_mapping_csv}, output redirect rules in {server_type} format (Apache/.htaccess, Nginx, or Cloudflare). Include regex patterns for bulk path redirects and validation test cases...
technicalredirectsmigration
Audit v1.0

Technical Site Audit Scope Builder

Generates a prioritized technical site audit scope based on site size and CMS type.

You are a senior technical SEO consultant. Given the following site details — CMS: {cms}, page count: {page_count}, primary issues suspected: {issue_list} — produce a prioritized technical audit scope with specific checks, tools, and expected outputs for each area...
audittechnicalcrawl
Audit v1.0

Canonical Audit Conflict Finder

Detects self-referential canonical errors, cross-domain conflicts, and paginated canonical misuse across a URL set.

Analyze the following canonical tag data (CSV: url, canonical_tag, http_header_canonical, rel_prev, rel_next): {canonical_csv}. Identify: (1) self-canonicals on non-indexable pages, (2) cross-domain canonicals without explicit rel=canonical confirmation, (3) paginated pages using page-1 canonical incorrectly, (4) canonical loops. For each issue type, list affected URLs and the recommended fix...
auditcanonicalindexing
GEO v1.0

Citation Signal Prepublish Checklist

Runs a pre-publication GEO checklist to maximize the likelihood of a new article being cited by LLMs and AI Overviews.

Before publishing the article titled '{article_title}' targeting query '{target_query}', evaluate the draft: {article_draft} against the following GEO citation signals: (1) direct answer in first 100 words, (2) named entity density, (3) original data or statistic presence, (4) structured FAQ block, (5) author credential signals, (6) external citation count, (7) Article/HowTo/FAQPage schema. Score each signal and flag any below threshold...
geocitationpre-publish
Technical v1.0

Edge SEO Header Rule Builder

Generates edge-level HTTP header injection rules to add or modify SEO-critical headers without deploying application code.

Generate edge-level header rules for {site_url} deployed on {edge_platform} (e.g., Cloudflare, Fastly, Akamai) to implement the following SEO header requirements: {header_requirements_list} (including: X-Robots-Tag injection for {noindex_path_patterns}, canonical header injection for {canonical_path_patterns}, and Link preload headers for {preload_resource_urls}). Output as {edge_platform}-compatible configuration syntax with inline comments explaining each rule's SEO purpose...
technicaledge-seoheaders
Audit v1.0

Faceted Nav Indexing Waste Audit

Identifies which faceted navigation URL combinations are being indexed and estimates the crawl budget waste they create.

Using this crawl export of faceted URLs (CSV: url, indexable, crawl_hits, organic_sessions, canonical): {faceted_csv} for {site_url}, calculate the percentage of crawl budget consumed by faceted parameter combinations with zero organic sessions. Recommend which parameter patterns should be blocked via robots.txt, noindex, or canonical, and which have sufficient traffic to justify indexing...
auditfaceted-navcrawl-budget
GEO v1.0

Multi-LLM Answer Gap Matrix Builder

Compares answers from multiple LLMs for a query set to identify where your brand is absent and why.

For the following queries: {query_list}, compile the responses from ChatGPT, Claude, Gemini, and Perplexity. Build a gap matrix showing: which models mention {brand_name}, which competitor brands are mentioned instead, what factual claims differ across models, and which source types are cited. Prioritize the queries where {brand_name} is absent from all models and output a content intervention plan...
geomulti-llmcitation
Audit v1.0

Orphan Page Link Equity Sweep

Identifies orphan pages with ranking potential and prescribes internal link placements to restore equity flow.

Given the following list of URLs with zero internal inlinks: {orphan_url_list}, and the site's top-traffic pages: {top_pages_list}, identify which orphan pages have ranking potential based on their content topics, then recommend specific internal link placements (source URL, anchor text, target URL) to restore equity flow. Prioritize by estimated traffic impact...
auditinternal-linkscrawl
Ranking v1.0

PAA Intent Expansion Map

Extracts and clusters People Also Ask questions for a seed query set to map sub-intent coverage opportunities.

For the seed queries: {seed_query_list}, extract all available People Also Ask questions (up to 4 levels deep per query). Cluster the resulting questions by sub-intent type (definition, comparison, how-to, cost, alternative, troubleshooting). For each cluster, identify which sub-intents are unaddressed by {your_domain}'s existing content and output a prioritized FAQ or section expansion brief...
rankingpaaintent
Audit v1.0

Security Header SEO Risk Sweep

Evaluates HTTP security headers for configurations that block crawlers, break rendering, or suppress indexing signals.

Analyze the following HTTP response headers for {site_url}: {headers_json}. Identify any security header configurations that may negatively impact SEO, including: CSP directives blocking Googlebot's ability to render JS resources, X-Frame-Options misuse, HSTS configurations causing redirect loops, and missing or misconfigured CORS headers affecting cross-domain resource loading. Provide corrected header values for each issue...
auditsecurity-headerstechnical
Ranking v1.0

SERP Intent Mismatch Priority Fix

Flags pages ranking for queries where their content intent mismatches SERP dominant intent, with rewrite recommendations.

For the following pages and their ranking queries (CSV: page_url, ranking_query, current_rank, page_intent, serp_dominant_intent): {intent_mismatch_csv}, identify cases where the page intent conflicts with the SERP dominant intent (e.g., commercial page ranking for informational query). For each mismatch, estimate traffic loss risk, then recommend whether to rewrite, create a new page, or restructure the existing content to align intent...
rankingintentserp
GEO v1.0

Brand Mention Citation Gap Audit

Diagnoses where brand mentions exist but are not converting into LLM citations.

You are a GEO brand analyst. Given the following brand mention dataset {mention_data} and LLM citation log {citation_log}, identify mention contexts that fail to generate citations. Analyze structural, authority, and contextual factors and output an action plan to convert mentions into citations...
geobrand-mentioncitation-gap
Content v1.0

Content Outline Authority Signal Map

Builds a content outline that embeds E-E-A-T authority signals at each structural section.

You are a content authority strategist. For the topic {topic} targeting {audience}, create a detailed content outline where each H2/H3 section includes: the sub-topic to cover, required evidence type (study, case, expert quote, first-hand example), and specific E-E-A-T signal to embed. Audience expertise level: {expertise_level}...
contente-e-a-tcontent-outline
GEO v1.0

Entity Prominence Signal Builder

Designs an entity prominence strategy to strengthen how LLMs associate a brand with its core topics.

Act as an entity SEO strategist. For brand {brand} operating in {industry}, map the core entities LLMs currently associate with the brand versus desired associations. Produce a 90-day signal-building plan covering content, structured data, and third-party mention strategies...
geoentitybrand-association
Ranking v1.0

Image SERP Feature Optimizer

Identifies image SEO signals needed to capture image SERP features for target queries.

You are an image SEO specialist. For the target queries {query_list}, analyze which images currently rank in image SERP features. Extract shared signals — file naming, alt text patterns, surrounding content, page authority, structured data — and produce an optimization checklist for {brand}'s image assets...
rankingimage-serpimage-seo
Audit v1.0

Indexing Anomaly Diagnostic

Diagnoses why pages are excluded from Google's index using GSC coverage data.

Act as a Google Search Console specialist. Given the following GSC indexing coverage export {gsc_export}, categorize all non-indexed URLs by exclusion reason, identify the most impactful patterns, and provide a remediation plan ordered by estimated traffic recovery...
auditindexinggsc
Ranking v1.0

Local Pack Prominence Gap Plan

Compares local pack ranking signals against top competitors to build a prominence improvement plan.

Act as a local SEO strategist. For {business_name} targeting the query {target_query} in {location}, compare its Google Business Profile signals, review velocity, citation consistency, and proximity factors against the current top 3 local pack competitors. Output a ranked action plan to improve local pack prominence...
rankinglocal-packlocal-seo
Audit v1.0

Log File Crawl Waste Identifier

Analyzes raw log file data to surface URLs wasting Googlebot crawl budget.

You are an SEO log file analyst. Review the following Googlebot log file sample: {log_sample}. Identify URL patterns consuming disproportionate crawl budget, classify each as high/medium/low waste, and recommend directives to reclaim budget...
auditlog-filecrawl-budget
Ranking v1.0

News SERP Freshness Signal Architect

Builds a freshness signal strategy to improve news SERP inclusion and Top Stories eligibility.

You are a news SEO specialist. For {publication} targeting Top Stories inclusion for topic {topic}, audit current freshness signals: publication date markup, update frequency, byline schema, AMP status, and Google News sitemap configuration. Produce a prioritized signal improvement plan...
rankingnews-serpfreshness
Content v1.0

Programmatic Content Entity Seeder

Designs entity-seeded templates for programmatic content pages that avoid thin content penalties.

Act as a programmatic SEO architect. For the content template type {template_type} targeting {n} location/category combinations, design a content template that ensures entity uniqueness, minimum content depth requirements, and differentiated value per page. Include dynamic entity slots, required static content blocks, and quality thresholds...
contentprogrammatic-seoentity
GEO v1.0

Source Authority Signal Modeler

Models the authority signals LLMs likely use to rank sources for a competitive topic.

Act as a generative engine optimization researcher. For the topic {topic}, analyze the top {n} sources cited across ChatGPT, Perplexity, and Gemini. Identify shared authority signals — domain age, link profile, author credentials, content structure — and model a signal acquisition roadmap for {brand}...
geosource-authorityllm
GEO v1.0

ChatGPT Entity Citation Gap Finder

Identifies entity and topic gaps preventing ChatGPT from citing your brand in relevant answers.

Test ChatGPT responses for the following {query_list} related to {brand}'s core product area. For each response where {brand} is not cited, analyze the cited sources for common entity signals, content formats, and authority markers that {brand} content is missing...
geochatgptentity
GEO v1.0

Citation Pre-Publish Content Checklist

Validates content against LLM citation readiness criteria before publication.

Before publishing the following content draft for {page_url}, evaluate it against these LLM citation readiness criteria: factual claim sourcing, entity definition clarity, answer completeness, structured formatting, and author credibility signals. Output a pass/fail checklist with fix instructions...
geocitationpre-publish
Ranking v1.0

Competitor Gap Cluster Opportunity

Sizes ranking opportunities in topic clusters where competitors rank but your site has no presence.

Using ranking data for {competitor_list} and {site_url} across the topic cluster {topic_cluster}, identify keyword gaps where all listed competitors rank in the top 20 but {site_url} does not. Score each gap by search volume, difficulty, and content investment required...
rankingcompetitor-gapcluster
Content v1.0

Content Decay Traffic Segment Audit

Segments decaying content by decay cause type—freshness, competition, or intent shift—for targeted fixes.

Analyze the traffic trend data for the following declining pages on {site_url} over {date_range}. Classify each page's decay into one of these root causes: content staleness, new competitor entry, SERP intent shift, or cannibalization. Assign a recovery tactic per cause...
contentcontent-decaytraffic
Content v1.0

Content Outline SERP Intent Builder

Builds a content outline aligned to dominant SERP intent and top-ranking content structures.

Analyze the top 10 ranking pages for {target_keyword} and extract the dominant heading structure, content format, and intent signals. Produce a detailed outline for a new piece for {site_url} that matches SERP intent while differentiating on depth and authority...
contentoutlineserp-intent
Audit v1.0

CrUX Field Data Gap Finder

Compares CrUX field data against lab results to surface real-user CWV gaps by page segment.

Compare the CrUX field data and lab measurement results for {site_url} provided below. Identify pages where field and lab INP, LCP, or CLS scores diverge significantly, and hypothesize root causes for each delta...
auditcore-web-vitalscrux
Content v1.0

FAQ Entity Schema Block Drafter

Generates FAQ blocks with embedded entity signals and FAQPage schema markup for rich result eligibility.

Generate a set of {faq_count} FAQ items for the topic {topic} on {site_url}. Each FAQ must include a question matching real PAA queries, a concise authoritative answer under 300 characters, relevant entity mentions, and be formatted as valid FAQPage JSON-LD schema...
contentfaqschema
Ranking v1.0

Featured Snippet Format Gap Analysis

Matches target queries to their required snippet format and gaps your content against those formats.

For the target keyword list {keyword_list}, determine the dominant featured snippet format currently ranking (paragraph, list, table, or step-by-step). For each, evaluate whether {site_url}'s content matches that format and output a structured rewrite brief per gap...
rankingfeatured-snippetformat
GEO v1.0

Generative SERP Feature Fit Scorer

Scores content pages for fit against generative SERP features including AI Overviews and AI Mode.

Score the following {page_list} for {site_url} against generative SERP feature eligibility criteria. For each page, evaluate passage clarity, entity density, factual accuracy markers, and format compatibility, producing a tiered fit score with improvement notes...
geogenerative-serpai-overview
GEO v1.0

GEO Entity Prominence Signal Brief

Builds a brief for increasing entity prominence signals so LLMs associate your brand with target topics.

For {brand} targeting the topic cluster {topic_cluster}, audit current entity prominence signals across Wikipedia, Wikidata, knowledge panels, and major publications. Identify the top five gaps and produce a six-week entity prominence action plan...
geoentitybrand
Technical v1.0

Hreflang Sitemap Locale Config Builder

Generates a complete hreflang XML sitemap configuration for a multi-locale site structure.

Build a complete hreflang XML sitemap index for {site_url} supporting the following locale and URL mapping: {locale_url_table}. Include x-default entries, self-referencing hreflang tags, and validate output against Google's hreflang sitemap specification...
technicalhreflangsitemap
Technical v1.0

JSON-LD Breadcrumb Organization Builder

Generates valid JSON-LD for BreadcrumbList and Organization schema for site-wide implementation.

Generate valid JSON-LD markup for BreadcrumbList schema for the URL path {url_path} on {site_url} and a complete Organization schema block using the following brand details: {brand_details}. Validate all required and recommended properties per schema.org and Google's documentation...
technicaljson-ldschema
Audit v1.0

Mobile JS Render Gap Check

Detects content missing from mobile-rendered HTML that appears only after JavaScript execution.

Compare the raw HTML and fully rendered DOM for the following URLs on {site_url} as seen by a mobile Googlebot user-agent. List all content, links, and schema markup present post-render but absent in raw HTML...
auditmobile-firstjavascript
GEO v1.0

Multi-LLM Citation Source Tester

Tests citation patterns across multiple LLMs for the same query set to reveal source preference divergence.

Run the following {query_list} through ChatGPT, Claude, and Perplexity. For each query, record which sources are cited by each LLM, identify sources cited by all three versus only one, and produce a comparative citation coverage matrix...
geomulti-llmcitation
Audit v1.0

Orphan Page Discovery Report

Detects orphan pages by cross-referencing crawl data with sitemap and internal link sources.

Using the crawl export, XML sitemap URLs, and internal link data for {site_url} provided below, identify all orphan pages receiving no internal links. Rank by estimated traffic loss and recommend re-integration paths...
auditorphan-pagesinternal-links
GEO v1.0

Perplexity Competitor Source Gap

Compares competitor citation frequency in Perplexity results against your own to find source gaps.

Given the Perplexity search results for the queries {query_list} in the {niche} space, compare citation frequency and context for {brand} versus {competitor_list}. Identify topics where competitors are cited and {brand} is absent, and recommend content actions...
geoperplexitycompetitor
Technical v1.0

Prerender SEO Eligibility Spec

Defines which URL segments qualify for prerendering and configures the prerender rules for SEO bots.

Produce a prerendering eligibility specification for {site_url}. Define URL patterns that should be prerendered for search engine bots versus served dynamically, configure the Speculation Rules API or {prerender_service} integration, and include bot detection logic to serve prerendered HTML only to crawlers...
technicalprerenderingjavascript
Audit v1.0

Schema Entity Type Auditor

Finds missing schema entity types across key page templates to close structured data gaps.

Review the following list of page templates for {site_url} and identify which schema.org entity types are absent or incomplete. For each gap, specify the recommended type, required properties, and SEO impact...
auditschemastructured-data
Audit v1.0

Log File Anomaly Detector

Identifies crawl anomalies and bot behavior patterns from raw server log data.

Analyze the following server log file excerpt for {site_url} and identify crawl anomalies, unexpected bot behavior, and pages being over- or under-crawled by Googlebot. Provide a prioritized action list...
auditlog-filecrawl
GEO v1.0

AI Overview Brand Inclusion Audit

Audits which queries trigger AI Overviews that cite competitors but exclude your brand as a source.

For the following list of target queries for {brand}: {query_list}, record which queries generate Google AI Overviews. For each AI Overview that cites competitor sources but omits {brand}, analyze the cited sources' content structure, entity signals, and passage depth to identify inclusion gaps...
ai-overviewgeobrand
Ranking v1.0

Branded Query SERP Defense Plan

Creates a plan to reclaim branded SERP real estate from competitors and third-party review sites.

Analyze the current SERP for '{brand_name}' branded queries: {query_list}. Identify all page-1 results not owned by {domain} (competitors, review sites, forums, etc.). For each external result, classify the threat level and recommend a countermeasure: content creation, sitelinks optimization, structured data, or PR/link strategy...
brandedserpranking
GEO v1.0

AI Mode Passage Match Scorer

Scores existing page passages against AI Mode retrieval patterns to estimate inclusion likelihood.

For each page in {url_list}, extract the top 5 candidate passages (150-300 words each) most likely to be retrieved by Google AI Mode for the query '{query}'. Score each passage on semantic match, entity density, factual specificity, and source trustworthiness signals on a 1-10 scale with improvement notes...
ai-modepassagegeo
GEO v1.0

ChatGPT Entity Salience Audit

Tests how prominently ChatGPT surfaces brand entities relative to competitors in category answers.

Submit the following category-level prompts to ChatGPT: {prompt_list}. For each response, score the salience of {brand} mentions versus top 5 competitors using a 0-3 scale (0=absent, 1=peripheral, 2=mentioned, 3=leading). Output a salience table and identify entity association gaps to close...
chatgptentitygeo
GEO v1.0

Claude Topical Authority Gap Finder

Identifies topical sub-areas where Claude fails to cite brand content despite relevant coverage.

Submit the following topical queries to Claude: {query_list}. For each response that does not cite {domain}, extract the sub-topics and angles that Claude addresses. Cross-reference against {domain}'s content inventory to identify coverage gaps and recommend new content angles that align with Claude's response patterns...
claudegeotopical-authority
Content v1.0

Content Refresh Traffic Loss Brief

Generates a targeted refresh brief for a decaying page based on traffic loss root cause analysis.

The page at {url} has lost {traffic_loss}% of organic traffic over the past {time_period}. Analyze the current content against updated SERP results for '{target_keyword}'. Identify whether the decay is caused by intent drift, freshness gaps, lost backlinks, or new competitor content. Output a prioritized refresh brief addressing each root cause...
content-refreshcontent-decaycontent
Content v1.0

FAQ Intent Coverage Generator

Generates FAQ content blocks targeting PAA and voice search intents for a given topic page.

For the page targeting '{primary_keyword}', generate 10 FAQ entries that collectively cover the full intent spectrum: definitional, how-to, comparison, troubleshooting, and cost/value. Each answer should be 40-60 words, directly answer the question in the first sentence, and be formatted for FAQPage schema markup...
faqcontentschema
GEO v1.0

GEO Content Entity Density Brief

Generates a content brief focused on increasing named entity density to improve LLM citability.

Create a GEO-optimized content brief for the topic '{topic}' targeting {brand}. Identify the top 15 named entities (people, organizations, concepts, locations) that LLMs associate with this topic based on their training signals. Specify where each entity should appear in the content and at what density...
geoentitycontent-brief
Technical v1.0

Hreflang Matrix Return Tag Checker

Validates that every hreflang tag has a matching return tag across all locale pairs in the cluster.

Given the hreflang implementation for the page cluster {url_cluster}, map every hreflang tag across all locale variants into a matrix. Identify any missing return tags, incorrect x-default assignments, locale code errors (e.g., 'en' vs 'en-US'), and mismatched canonical/hreflang combinations. Output a corrected hreflang tag set...
hreflangtechnicalinternational
Technical v1.0

INP Interaction Event Trace Plan

Generates a diagnostic plan for tracing slow INP interactions to their JavaScript event root cause.

For the page {url} with a CrUX INP score of {inp_value}ms, create a step-by-step diagnostic plan using Chrome DevTools Performance panel and the Web Vitals JS library. Identify how to isolate the longest interaction event, attribute processing delay to specific JS tasks or third-party scripts, and recommend deferral or chunking strategies...
inpperformancetechnical
Technical v1.0

JS Render Content Delta Detector

Compares raw HTML against rendered DOM to surface SEO-critical content hidden behind JavaScript.

Compare the raw HTML source and the fully rendered DOM for {url}. Identify all SEO-critical elements present in the rendered DOM but absent in the raw HTML: headings, body copy, internal links, structured data, and canonical tags. For each delta, classify the rendering dependency and recommend whether to SSR, prerender, or defer the element...
javascriptrenderingtechnical
Technical v1.0

LCP Resource Load Chain Auditor

Traces the full resource load chain for the LCP element to identify delay sources and fix priorities.

For the page {url} where the LCP element is '{lcp_element}', trace the full resource load chain using a WebPageTest waterfall. Identify render-blocking resources, discovery delays (no preload hint), network round-trips, and server TTFB contribution. Output a prioritized list of load-chain fixes with estimated LCP improvement per fix...
lcpperformancetechnical
Ranking v1.0

Local Pack Proximity Gap Analyzer

Analyzes local pack ranking gaps by location radius for multi-location or service-area businesses.

For the target query '{local_query}' and business '{business_name}', run a grid-based local rank tracking analysis across a {radius} radius at {interval} intervals. Identify zones where the business falls outside the local 3-pack, compare the GBP signals of ranking competitors in those zones, and recommend citation and content actions...
local-packrankinggeo
Content v1.0

Meta Title Batch CTR Rewriter

Rewrites a batch of underperforming title tags using CTR-optimization patterns from SERP analysis.

For each URL in {url_list}, the current title tag and GSC CTR data are provided: {title_ctr_data}. For each title with CTR below {ctr_threshold}%, rewrite the title tag to improve click-through using power words, number inclusion, bracketed modifiers, or query mirroring. Keep each title under 60 characters and aligned to the page's primary keyword...
title-tagctrcontent
GEO v1.0

Multi-LLM Citation Overlap Matrix

Maps source citation overlap and divergence across ChatGPT, Perplexity, Claude, and Gemini.

Run the following query set: {query_list} across ChatGPT, Perplexity, Claude, and Gemini. Record every cited URL per model per query and build an overlap matrix showing which sources appear in all models, some models, or only one model. Identify {domain} pages and flag coverage gaps...
multi-llmcitationgeo
Audit v1.0

Orphan Page Link Recovery Planner

Identifies orphan pages and generates internal linking recommendations to restore crawl equity.

Using the following crawl export for {domain}, identify all URLs receiving zero internal links. Cross-reference against GSC impressions data to flag orphan pages with residual ranking value, then recommend the top 3 most contextually relevant pages to link from for each orphan...
orphan-pagesinternal-linksaudit
GEO v1.0

Perplexity Source Freshness Audit

Identifies whether Perplexity cites outdated competitor content over fresher brand-owned pages.

Query Perplexity with the following prompts related to {topic}: {query_list}. For each result, record cited sources and their publication dates. Flag cases where {domain} content exists on the topic but a competitor's older article is cited instead, and recommend content freshness signals to add...
perplexitygeofreshness
Technical v1.0

Robots.txt Crawl Risk Auditor

Reviews a robots.txt file for over-blocking, under-blocking, and conflicting directive risks.

Analyze the following robots.txt file for {domain}: {robots_txt_content}. Identify directives that block critical resources (JS, CSS, key URL patterns), conflicting rules between user-agent groups, and missing disallows for parameter-heavy or faceted URLs. Output a risk-scored directive table with recommended corrections...
robots-txtcrawltechnical
Technical v1.0

Schema Markup Property Completeness

Audits JSON-LD schema blocks for missing recommended properties that reduce rich result eligibility.

Review the following JSON-LD schema markup from {url}: {schema_block}. Cross-reference every property against Google's rich result requirements and recommendations for the schema type. Flag all missing required and recommended properties, provide the correct value format for each, and output an updated, complete JSON-LD block...
schemajson-ldtechnical
GEO v1.0

Source Authority Tier Model

Builds a tiered authority model predicting which source types LLMs prefer to cite in a given niche.

For the niche '{niche}', analyze LLM citation behavior across 20 representative queries. Classify cited sources into tiers: T1 (government/academic), T2 (established media), T3 (industry authority), T4 (brand/commercial). Output the tier distribution and recommend which tier {domain} should emulate structurally...
geoauthoritycitation
Content v1.0

Topic Cluster Gap Content Identifier

Identifies missing spoke pages in an existing topic cluster that are needed to compete for head terms.

For the topic cluster centered on '{pillar_topic}' for {domain}, map all existing spoke pages and cross-reference against the top 50 ranking URLs for related queries. Identify content angles, subtopics, and question formats present in competitor clusters but absent from {domain}'s cluster, ranked by estimated traffic opportunity...
topic-clustercontent-gapcontent
Ranking v1.0

Video SERP Chapter Optimizer

Optimizes video content chapters and timestamps to improve eligibility for video SERP features.

For the video at {video_url} targeting the query '{target_query}', analyze the current chapter markers and timestamps. Compare chapter structure against the top 5 video SERP results for this query. Recommend revised chapter titles, timestamps, and VideoObject schema markup to maximize key-moment eligibility...
video-serprankingschema
Technical v1.0

XML Sitemap Health Gap Spec

Evaluates sitemap for non-indexable URLs, missing canonical URLs, and priority signal mismatches.

Audit the XML sitemap at {sitemap_url} for {domain}. Identify: (1) URLs in the sitemap that return non-200 status codes, (2) canonicalized-away URLs included in the sitemap, (3) noindex URLs, (4) high-value URLs missing from the sitemap. Output a remediation table sorted by estimated SEO impact...
sitemaptechnicalindexing
Content v1.0

Content Brief Intent SERP Match

Builds a content brief fully aligned to SERP intent signals, format patterns, and top-ranking page structures.

Create a content brief for the target keyword '{target_keyword}' on {domain}. Analyze the top 10 SERP results, extract dominant intent type, content format, average length, heading structure, and entity coverage. Output a brief with recommended format, outline, word count, and entity inclusion list...
contentbriefintent
Content v1.0

FAQ Content Intent Cluster Builder

Generates a FAQ block for a target page by clustering PAA and search query intent data into answer-ready questions.

For the target page '{page_url}' on {domain} covering '{topic}', extract related PAA questions, autocomplete queries, and forum questions. Cluster by intent, select the top {n} highest-traffic questions, and draft concise FAQ answers optimized for FAQPage schema and featured snippet extraction...
contentfaqintent
GEO v1.0

Generative SERP Passage Targeting Plan

Creates a passage-level content plan to maximize retrieval probability in generative SERP answer boxes.

For the target queries {query_list}, identify the passage formats (definition, list, how-to, comparison) most likely to be extracted by generative SERP features. Map existing {domain} content to these formats, flag format mismatches, and draft new passage templates for gaps...
geogenerative-serppassages
Audit v1.0

JS Rendering Content Visibility Check

Compares raw HTML vs rendered DOM to identify content invisible to crawlers due to JavaScript execution.

Compare the raw HTTP response HTML and the fully rendered DOM snapshots for the following {n} URLs on {domain}. Identify text, links, and structured data present only in the rendered version, assess SEO risk per page, and recommend SSR or prerender fixes...
auditjavascriptrendering
GEO v1.0

Multi-LLM Source Preference Matrix

Tests the same query across multiple LLMs and maps which sources each model prefers to cite for a given topic.

Submit the query '{target_query}' to ChatGPT, Claude, Perplexity, and Gemini. Record all cited or referenced sources per model, build a cross-model source preference matrix, and identify domains consistently preferred or ignored across all four models...
geomulti-llmcitations
Audit v1.0

Schema Markup Type Gap Auditor

Compares deployed schema types against page templates to surface missing or misapplied structured data.

Review the following list of page templates and their current schema markup implementations for {domain}. Identify templates missing recommended schema types, flag misapplied types, and prioritize fixes by rich-result eligibility...
auditschemastructured-data
Content v1.0

Schema-Rich Product Review Drafter

Drafts a product review content template structured to maximize Review and Product schema rich-result eligibility.

Draft a product review article template for '{product_name}' on {domain}. Structure the content to satisfy Google's Review schema requirements: include reviewer credentials, hands-on experience signals, pro/con sections, and a structured rating. Embed JSON-LD Review and Product schema annotations inline...
contentschemareview
Ranking v1.0

SERP Intent Cluster Gap Finder

Maps SERP intent types across a keyword cluster and identifies intent gaps where the domain lacks coverage.

Analyze the SERPs for the following {n} keywords in the {niche} cluster. Classify each SERP by dominant intent type (informational, navigational, commercial, transactional). Identify intent types where {domain} has no ranking content and output a gap-prioritized content brief list...
rankingintentserp
Ranking v1.0

SERP Volatility Pattern Classifier

Classifies ranking volatility patterns to distinguish algorithm updates from technical issues or competitor surges.

Analyze the ranking history for {domain} across {n} tracked keywords over the past {weeks} weeks. Identify volatility events, classify each by pattern type (algorithm update, competitor surge, technical incident, content freshness drop), and recommend response actions per pattern type...
rankingvolatilityserp
Technical v1.0

Sitemap Index Segmentation Spec

Designs a segmented sitemap index architecture to improve crawl prioritization across large site sections.

Design a sitemap index architecture for {domain} containing {n} total indexable URLs across the following content types: {content_types}. Define sitemap file segments by priority tier, recommend lastmod update frequency per segment, and output the sitemap index XML structure with example child sitemap entries...
technicalsitemapcrawl
GEO v1.0

Source Authority Signal Calibration

Benchmarks a domain's authority signals against LLM-cited competitors to find citation eligibility gaps.

Compare the authority signals of {domain} against the following {n} competitor domains that are regularly cited by LLMs in {topic_area}. Evaluate domain age, backlink quality, E-E-A-T markers, and structured data completeness. Output a gap score and prioritized action list...
geoauthorityllm
Content v1.0

Topic Cluster Hub-Spoke Gap Mapper

Audits an existing topic cluster for missing spoke pages and recommends new content to complete the cluster.

Analyze the current hub page and existing spoke pages for the '{cluster_topic}' cluster on {domain}. Identify subtopics covered by competitors but missing from {domain}'s cluster, estimate search demand per gap, and output a prioritized spoke content creation plan with recommended URLs and titles...
contenttopic-clustergap
Ranking v1.0

Video SERP Timestamp Optimization Plan

Analyzes video SERP features and recommends timestamp, schema, and description optimizations to improve visibility.

Review the video SERP results for {target_query}. Identify videos earning key moment timestamps, analyze their chapter structures and VideoObject schema implementations. Compare against {domain}'s video content and produce a timestamp and schema optimization plan for each video asset...
rankingvideo-serpschema
GEO v1.0

AI Mode Visibility Content Audit

Audits existing content for structural features that improve visibility in Google's AI Mode.

Review the content inventory below for {site_url} and score each page on AI Mode visibility factors: direct answer presence, structured heading hierarchy, entity markup, author E-E-A-T signals, and citation-worthy claim density. Output a ranked list of pages to prioritize for AI Mode optimization with specific edit recommendations...
geoai-modecontent-audit
GEO v1.0

Brand Mention Context Gap Mapper

Maps the topical contexts in which your brand is mentioned vs competitors in LLM outputs.

Collect LLM responses for the 15 queries below across ChatGPT and Perplexity. Extract every mention of {brand_name} and {competitor_brands} and tag each mention by topical context (e.g., pricing, use case, industry, geography). Build a context gap matrix showing where {brand_name} is under-mentioned relative to competitors...
geobrand-mentionscontext-gap
Ranking v1.0

Branded Query Intent Coverage Planner

Maps branded query variants to ensure full SERP ownership across all intent types.

Compile all branded query variants for {brand_name} from the Search Console data below. Group them by intent type: navigational, informational, review-seeking, comparison, and transactional. For each intent group where {brand_name} does not own the top 3 SERP results, identify which page should rank and what content or structured data change would strengthen its signal...
rankingbrandedserp
Audit v1.0

Canonical Loop Detection Audit

Detects circular or self-conflicting canonical chains that undermine indexing signals.

Review the canonical tag data below for {site_url} and identify: (1) canonical loops where URL A canonicalizes to URL B which canonicalizes back to A, (2) pages that self-canonicalize but have a different canonical in the HTTP header, (3) paginated pages that canonicalize to page 1 incorrectly. Output each conflict with a recommended resolution...
auditcanonicalindexing
GEO v1.0

ChatGPT Entity Salience Optimizer

Optimizes entity prominence in content so ChatGPT associates your brand with target topics.

Analyze the content below for {page_url} through the lens of entity salience for ChatGPT training and retrieval. Identify the primary entities present, their co-occurrence with {brand_name}, and gaps where competitor brands have stronger entity associations. Propose specific content edits to raise {brand_name}'s entity salience score...
geochatgptentity-salience
Content v1.0

Content Outline Intent Signal Brief

Builds a full content outline with intent-mapped section briefs for each major heading.

Create a detailed content outline for an article targeting '{primary_keyword}' on {site_url}. For each H2 and H3, specify: the micro-intent it satisfies, required entities to mention, recommended word count range, whether a supporting visual is needed, and any structured data opportunity. Align the overall structure to the dominant SERP intent and note where the outline improves on the current top-ranking result...
contentcontent-outlineintent
Content v1.0

Content Refresh Traffic Loss Triage

Triages a list of traffic-declining pages and prescribes a targeted refresh action for each.

Analyze the content decay data below showing organic traffic trends for {site_url} pages over the last 12 months. For each page with greater than {threshold}% traffic decline, diagnose the primary decay cause (freshness, SERP feature displacement, cannibalization, intent drift, or link loss) and prescribe a specific refresh action: update statistics, rewrite intro, add FAQ schema, acquire links, or consolidate...
contentcontent-refreshdecay
Audit v1.0

Core Web Vitals Origin Summary Audit

Interprets CrUX origin-level CWV data to triage the highest-impact performance regressions.

You are a CWV specialist. Review the CrUX origin summary data below for {site_url} covering the last 28 days. Identify which metrics (LCP, INP, CLS) fall into the 'needs improvement' or 'poor' thresholds, break results down by device type, and rank the top three root-cause hypotheses for each failing metric...
auditcore-web-vitalsperformance
Content v1.0

FAQ Intent to Schema Converter

Converts raw user questions into optimized FAQ content blocks with FAQPage schema markup.

Take the list of user questions below for the topic '{topic}' sourced from PAA, Search Console, and customer support data. Write a direct, expert answer (50–80 words) for each question. Then generate the complete FAQPage JSON-LD schema block incorporating all Q&A pairs, ensuring each answer is self-contained and does not require additional context to be understood by an LLM or SERP feature...
contentfaqschema
Ranking v1.0

Featured Snippet Competitor Gap Hunter

Finds featured snippet opportunities where competitors hold the snippet but your page ranks nearby.

Using the keyword ranking data below for {site_url}, identify all queries where a competitor holds a featured snippet and your domain ranks in positions 2–10. For each opportunity, classify the snippet type (paragraph, list, table, video), estimate monthly search volume, and recommend the minimum content change needed to displace the current snippet holder...
rankingfeatured-snippetcompetitor-gap
GEO v1.0

Generative SERP Topic Cluster Planner

Designs a topic cluster strategy optimized for citation in generative SERP features.

Build a topic cluster plan for {brand_name} in the '{topic_area}' space, specifically optimized for generative SERP citation. For each cluster pillar, define: the primary generative query it targets, required entity coverage, ideal content format, minimum source authority signals needed, and internal linking structure to pass topical authority...
geotopic-clustergenerative-serp
Technical v1.0

JSON-LD Product Schema Generator

Generates complete Product JSON-LD schema with all rich-result-eligible properties for e-commerce pages.

Using the product data below for {product_name} on {site_url}, generate a complete Product JSON-LD schema block. Include: name, description, image (array), brand (Organization), sku, gtin13, offers (with price, priceCurrency, availability, url, priceValidUntil), aggregateRating, and review (at least one). Validate that all required properties for Google's Product rich result are present and flag any missing recommended properties...
technicalschemajson-ld
Ranking v1.0

Keyword Cannibalization Intent Router

Resolves keyword cannibalization by assigning each cannibalizing URL a distinct intent lane.

Analyze the keyword cannibalization report below for {site_url}. For each cannibalizing URL pair, classify the primary search intent of each URL (informational, navigational, commercial, transactional), determine which URL is the stronger candidate to own the keyword, and prescribe one of: consolidate, redirect, re-optimize, or differentiate — with specific action steps...
rankingcannibalizationintent
GEO v1.0

LLM Recency Signal Gap Fixer

Diagnoses why LLMs surface stale brand information and prescribes a freshness signal fix plan.

Given that {llm_platform} is returning outdated information about {brand_name} (specifically: {outdated_claim}), analyze the likely cause from the following options: (1) low crawl frequency of authoritative pages, (2) absence of structured data timestamps, (3) lack of third-party citation of updated facts. Produce a fix plan with specific content and off-site actions...
georecencyfreshness
Audit v1.0

Log File Bot Intent Classifier

Classifies crawler bot behavior from raw log file data to surface crawl waste and priority gaps.

Analyze the server log file excerpt below for {site_url} and classify each bot's visit patterns by intent: discovery crawl, recrawl, error retry, or sitemap-driven. Flag any URLs where Googlebot frequency diverges significantly from page importance...
auditlog-filecrawl-budget
GEO v1.0

Multi-LLM Answer Freshness Tester

Tests whether LLMs return outdated brand or product information across multiple AI platforms.

For each query in the test set below, submit it to ChatGPT, Claude, Gemini, and Perplexity. Record the response date references, brand facts cited, and product details mentioned for {brand_name}. Flag any response that references outdated information (pre-{cutoff_date}) and recommend a freshness signal strategy to correct each gap...
geomulti-llmfreshness
Ranking v1.0

News Serp Freshness Architecture Plan

Designs a content publishing architecture optimized for sustained News SERP inclusion.

Audit the current news content structure of {site_url} against Google News inclusion requirements. Identify gaps in: URL date structure, article schema datePublished/dateModified accuracy, byline and author markup, AMP/Web Stories eligibility, and publication cadence. Produce a 90-day publishing architecture plan to achieve and maintain News SERP inclusion for '{topic_vertical}'...
rankingnews-serpfreshness
Audit v1.0

Orphan Page Traffic Impact Audit

Identifies orphan pages that still receive organic traffic, prioritizing link equity recovery.

Cross-reference the orphan page list (pages with zero internal inlinks) from {site_url}'s crawl export against the organic traffic data below. Rank orphan pages by monthly organic sessions descending, and for each recommend the most logical linking source page from the crawl data...
auditorphan-pagesinternal-links
Content v1.0

Programmatic SEO Page Template Spec

Specs a programmatic SEO page template with dynamic content rules to avoid thin-content penalties.

Design a programmatic SEO page template for {site_url} targeting the '{entity_type} + {modifier}' pattern. Define: the dynamic content modules and their minimum quality thresholds, which fields require human editorial review, rules for suppressing pages below quality threshold, internal linking logic, and the schema markup strategy. Include a checklist to validate each generated page before indexing...
contentprogrammatic-seotemplate
Audit v1.0

Schema Markup Entity Audit

Audits existing schema markup across page types to find entity gaps and mis-mappings.

Review the schema markup inventory below for {site_url} and identify: (1) page types missing schema entirely, (2) schema types present but mis-mapped to wrong page templates, (3) entity properties that are empty or use non-standard values. Output a gap table with recommended @type and property fixes...
auditschemaentities
Technical v1.0

Security Headers SEO Impact Matrix

Evaluates current security headers for configurations that unintentionally harm SEO crawling or rendering.

Review the HTTP response headers below for {site_url} and evaluate each security header (CSP, X-Frame-Options, Permissions-Policy, COEP, COOP, CORP) for configurations that may: block Googlebot's ability to render JavaScript resources, prevent third-party scripts required for structured data, or interfere with link equity via frame-based embeds. For each problematic header value, provide the corrected directive that maintains security posture while restoring SEO compatibility...
technicalsecurity-headersrendering
Technical v1.0

Server-Side Rendering SEO Decision Tree

Produces an SSR vs CSR vs hybrid rendering decision tree tailored to a site's SEO requirements.

Given the rendering architecture requirements for {site_url} (framework: {framework}, content types: {content_types}, update frequency: {update_frequency}), produce a rendering decision tree covering each major page template. For each template, recommend SSR, CSR, SSG, or ISR and justify the recommendation with SEO-specific reasoning covering: crawlability, content freshness, JS budget impact, and Time-to-First-Byte targets...
technicalrenderingssr
Technical v1.0

Sitemap XML Segmentation Spec

Designs a segmented sitemap index architecture for large sites to optimize Google's sitemap processing.

Design a sitemap index architecture for {site_url}, which has {url_count} indexable URLs across {page_type_list} page types. Specify how to segment URLs across child sitemaps (by page type, publication date, or priority tier), recommended lastmod date-format precision per segment, which segments to reference in Search Console separately, and the update frequency logic for each sitemap file...
technicalsitemaparchitecture
Content v1.0

Title Meta SERP Preview Optimizer

Rewrites title tags and meta descriptions to maximize SERP CTR using intent and emotion signals.

Rewrite the title tag and meta description for the following {n} URLs from {site_url}. For each URL, the new title must: include the primary keyword within the first 60 characters, use a power word or number where natural, and stay under 60 characters. The meta description must: include a benefit-driven CTA, reference the primary keyword, and stay under 155 characters. Output in a table with columns: URL | Current Title | New Title | Current Meta | New Meta...
contenttitle-tagsctr
GEO v1.0

AI Overview Entity Depth Scorer

Scores how deeply a page covers entities required for AI Overview citation eligibility.

Evaluate the following page content from {url} against the AI Overview result for the query '{target_query}'. Score entity coverage depth (0–10) for each named entity, concept, and relationship present in the AI Overview snippet. Identify entity gaps that, if filled, would strengthen citation eligibility...
geoai-overviewentity
Audit v1.0

Canonical Loop Conflict Finder

Detects canonical self-loops, cross-canonical conflicts, and paginated canonical misuse.

Analyze the following list of URLs and their declared canonical tags for {domain}: {canonical_data}. Identify: (1) self-referencing canonicals that contradict pagination signals, (2) canonical loops where A→B and B→A, (3) canonicals pointing to non-indexable pages. Output a fix table...
auditcanonicalindexing
Technical v1.0

CDN Cache TTL SEO Config Spec

Designs CDN cache TTL rules optimized for SEO crawl efficiency and content freshness.

Design a CDN cache TTL configuration for {domain} that balances crawl efficiency with content freshness. For each page type ({page_type_list}), specify Cache-Control headers (max-age, s-maxage, stale-while-revalidate), Vary header rules, and purge trigger logic. Justify each TTL value based on crawl frequency and update cadence...
technicalcdncache
GEO v1.0

Claude Brand Citation Readiness Score

Scores brand content readiness for Claude citation across key topical queries.

Test the following queries {query_list} in Claude and record the full response. For {brand}, score citation readiness (0–10) based on: entity completeness, topical authority signals, content recency, and source format compatibility. Produce a per-query improvement plan for uncited or weakly cited results...
geoclaudecitation
Technical v1.0

Cloudflare Worker Canonical Redirect Rule

Generates a Cloudflare Worker script to enforce canonical URL patterns at the edge.

Write a Cloudflare Worker script for {domain} that enforces the following canonical URL rules at the edge: {rule_list}. The worker must handle trailing slash normalization, www/non-www consolidation, and parameter stripping for {param_list}, returning 301 redirects for non-canonical patterns without origin server roundtrips...
technicalcloudflareedge-seo
Ranking v1.0

Competitor Featured Snippet Takeover

Identifies competitor-owned featured snippets and builds content to displace them.

For the following keyword set {keyword_list} where {competitor_domain} currently holds featured snippets, analyze each snippet's format (paragraph/list/table), word count, and structural triggers. Produce a page-level optimization plan for {domain} to displace each snippet, including exact content reformatting instructions...
rankingfeatured-snippetcompetitor
Content v1.0

Content Brief Competitor Intent Map

Builds a content brief by mapping competitor page intent signals for a target keyword.

For the target keyword '{keyword}', analyze the top 10 ranking pages and classify each by primary intent, content format, word count, heading structure, and entity coverage. Produce a content brief for {domain} that identifies the intent angle, structural format, and entity depth needed to competitively rank...
contentbriefintent
Content v1.0

Content Gap Position 11 Plan

Targets keywords where the site ranks 11–20 and creates content gap plans to break page one.

Using GSC data for {domain}, export all keywords ranking in positions 11–20 with search volume above {volume_threshold}. For each, compare {domain}'s ranking page against the top 3 results for content depth, format, entity coverage, and backlink profile gaps. Output a prioritized content improvement brief per URL...
contentgapranking
Audit v1.0

CrUX Gap Diagnostics Audit

Compares CrUX field data against lab data to surface real-user Core Web Vitals gaps.

Using the CrUX field data and lab data (Lighthouse/PageSpeed) provided below for {url_list}, identify pages where field and lab scores diverge by more than 20 percentile points for LCP, INP, or CLS. For each divergence, suggest the most likely root cause and remediation step...
auditcore-web-vitalscrux
Content v1.0

E-E-A-T Author Signal Enrichment Plan

Identifies missing author E-E-A-T signals on content pages and creates an enrichment plan.

Audit the author bylines, bio pages, and schema markup for authors on {domain}. For each author covering YMYL or high-competition topics, score E-E-A-T signals present (credentials, external mentions, linked social profiles, publication history). Produce a per-author enrichment plan with specific content and schema additions...
contente-e-a-tauthor
Content v1.0

FAQ Content Intent Gap Builder

Generates FAQs targeting unanswered intent gaps found in PAA and forum data.

For the topic '{topic}' on {domain}, mine People Also Ask results, Reddit threads, Quora posts, and competitor FAQ sections to identify questions not yet answered on {domain}. Generate a set of {num_faqs} FAQ entries with concise answers, each optimized for featured snippet and AI Overview retrieval...
contentfaqintent
GEO v1.0

GEO Source Selection Preference Audit

Reverse-engineers which content attributes cause LLMs to prefer competitor sources over yours.

Compare the top 5 sources cited by {llm_name} for queries in the '{topic}' category against {domain}'s content on the same topics. Identify structural, authority, and entity-depth differences that explain source preference. Output a gap-closing content brief for each competitor advantage...
geosource-selectionllm
Technical v1.0

Hreflang Sitemap Locale Validator

Validates hreflang locale codes in XML sitemaps for format compliance and completeness.

Parse the following hreflang XML sitemap for {domain}: {sitemap_data}. Validate that all hreflang attribute values use correct BCP 47 language-region tags, that x-default is present for each URL set, and that all alternate URLs return 200 status codes. Output a validation report with line-level error flags and corrected code...
technicalhreflangsitemap
Audit v1.0

Indexing Coverage Drop Investigation

Diagnoses sudden drops in Google Search Console indexing coverage with root-cause mapping.

Given the Google Search Console indexing coverage report export for {domain} covering {date_range}, identify URL categories showing the sharpest drop in indexed pages. For each category, map the most probable root cause (crawl block, noindex tag change, canonical shift, server error) and suggest immediate remediation steps...
auditindexinggsc
Technical v1.0

INP Event Handler Trace Fix

Diagnoses slow INP interactions by tracing event handler execution and main thread blocking.

Analyze the Chrome DevTools Performance trace for {url} focused on the INP interaction '{interaction_type}'. Identify the event handler chain, any long tasks blocking the main thread (>50ms), and third-party script contributions to interaction delay. Produce a prioritized fix list with code-level recommendations...
technicalinpperformance
Content v1.0

Internal Link Hub-Spoke Insertion Plan

Creates a specific internal link insertion plan from hub pages to underlinked spoke pages.

Given the content inventory and internal link graph for {domain}, identify the top {num_pages} spoke pages in the '{cluster}' cluster that receive fewer than {min_links} internal links from the hub page or related spokes. For each, recommend exact paragraph locations and anchor text for link insertion...
contentinternal-linkscluster
Technical v1.0

JSON-LD HowTo Schema Drafter

Generates complete, valid JSON-LD HowTo schema markup from a provided instructional content outline.

Convert the following how-to content outline for '{page_title}' into a complete, Google-compliant JSON-LD HowTo schema block. Include: name, description, totalTime (ISO 8601), estimatedCost if applicable, supply/tool arrays, and a HowToStep array with name, text, image, and url for each step...
technicalschemajson-ld
Content v1.0

Meta Description SERP Narrative Writer

Rewrites meta descriptions using SERP-competitive narrative framing to improve click-through.

For the following URLs on {domain}: {url_list}, retrieve current meta descriptions and SERP competitors' meta descriptions for the same query. Rewrite each meta description using the target keyword naturally, a clear value proposition, and a call to action, staying within 155 characters. Flag emotional triggers used by top competitors...
contentmeta-descriptionctr
Ranking v1.0

News SERP Freshness Velocity Plan

Builds a content publication velocity plan to capture and retain news SERP placements.

Analyze the news SERP for the topic '{topic}' over the past {time_period}. Identify the publication frequency, article freshness decay rate, and entity coverage patterns of the top 5 ranking sources. Produce a content velocity and update schedule for {domain} to achieve consistent news SERP inclusion...
rankingnews-serpfreshness
Ranking v1.0

PAA Question Format Optimizer

Rewrites content to match the exact answer format Google uses in People Also Ask boxes.

For the target query '{query}', extract all People Also Ask questions currently shown in the SERP. For each PAA question, analyze the format of the current winning answer (length, sentence structure, presence of definition, list, or step pattern) and rewrite {domain}'s answer content to match that winning format exactly...
rankingpaafeatured-snippet
GEO v1.0

Perplexity Source Authority Builder

Identifies authority signals that increase likelihood of Perplexity citing a domain as a source.

Analyze the current citation sources Perplexity uses for queries related to '{topic}' in the {industry} space. For {domain}, identify which authority signals (backlink profile, topical depth, recency, structured data) are weakest compared to cited competitors and produce an improvement roadmap...
geoperplexityauthority
Technical v1.0

Prerender Service Eligibility Config

Configures prerendering eligibility rules and bot detection logic for a JavaScript-heavy site.

Design a prerendering configuration for {domain} using {prerender_service}. Specify user-agent detection rules to route crawlers to prerendered HTML, define URL inclusion/exclusion patterns for {page_type_list}, set cache TTL per page type, and outline a quality assurance test to verify prerendered output matches intended SEO content...
technicalprerenderingrendering
Technical v1.0

Robots.txt Disallow Conflict Checker

Audits robots.txt for disallow rules that inadvertently block indexable or high-value URLs.

Analyze the following robots.txt file for {domain} and cross-reference all Disallow directives against the sitemap URL list and top organic landing pages from GSC. Identify any high-value or indexable URLs blocked by current rules, flag wildcard pattern conflicts, and produce a corrected robots.txt output...
technicalrobots-txtcrawl
Content v1.0

Programmatic SEO Content Schema Plan

Designs a programmatic content template with integrated schema for scalable page generation.

Design a programmatic content template for {domain}'s '{page_type}' page type targeting the keyword pattern '{keyword_pattern}'. Include: dynamic content variables, static E-E-A-T content blocks, required schema types (with property list), internal link logic, and thin-content safeguards to prevent quality issues at scale...
contentprogrammaticschema
Technical v1.0

Security Headers CSP SEO-Safe Spec

Generates a Content Security Policy and security header set that is safe for SEO rendering.

Create a complete security header configuration for {domain} including Content-Security-Policy, X-Frame-Options, Referrer-Policy, and Permissions-Policy. Ensure the CSP does not block Googlebot's rendering of JavaScript, inline styles required for Core Web Vitals, or third-party structured data tools. Output as HTTP header directives with SEO impact notes...
technicalsecurity-headerscsp
Ranking v1.0

SERP Intent Volatility Cluster Report

Identifies keyword clusters where search intent is shifting and rankings are most at risk.

Analyze the SERP history data for the keyword cluster {cluster_name} over the past {time_period}. Identify keywords where the dominant intent type (informational/commercial/transactional/navigational) has shifted, correlate with ranking drops for {domain}, and recommend content realignment actions...
rankingintentvolatility
Technical v1.0

SSR Hydration Gap Checker

Detects content and markup gaps between SSR initial payload and post-hydration DOM state.

Compare the server-side rendered HTML payload and the fully hydrated DOM state for the following URLs on {domain}: {url_list}. Identify any SEO-critical elements (title, meta, H1, canonical, structured data, body text) present in one state but absent in the other. Output a hydration gap report with fix recommendations...
technicalssrrendering
Audit v1.0

Site Log Anomaly Audit

Identifies crawl anomalies in server log data by bot type, status code, and URL pattern.

Analyze the following server log export for {domain} and identify crawl anomalies grouped by Googlebot vs other bots, HTTP status code (2xx/3xx/4xx/5xx), and URL pattern. Highlight URLs with disproportionate crawl frequency, large status-code error clusters, and any paths wasting crawl budget...
auditlog-filecrawl
Content v1.0

Title Tag CTR Split-Test Plan

Generates title tag variants for A/B testing to maximize organic CTR improvements.

For the following pages on {domain}: {url_list}, analyze current title tags, SERP position, and CTR from Search Console. For each page, generate 3 title tag variants using different emotional triggers, power words, number inclusion, and bracket patterns. Rank variants by predicted CTR lift and provide a testing schedule...
contenttitle-tagctr
Content v1.0

Topic Cluster Spoke Page Brief

Generates a detailed spoke-page content brief within an existing topic cluster architecture.

Given the hub page at {hub_url} for the cluster '{cluster_topic}', identify a gap spoke page on the subtopic '{subtopic}'. Produce a full content brief including: target keyword, search intent, recommended format, H2/H3 outline, entity list, internal linking targets, word count range, and E-E-A-T signals to include...
contentclusterbrief
Technical v1.0

XML Sitemap Priority Split Spec

Designs a split sitemap index architecture to optimize Googlebot crawl prioritization.

Design a sitemap index architecture for {domain} with {total_url_count} URLs. Split sitemaps by page type ({page_type_list}), assign appropriate priority and changefreq values based on update frequency and revenue importance, and specify lastmod automation logic. Output the full sitemap index XML and per-sitemap configuration specs...
technicalsitemapcrawl

Showing 2191 of 2191 prompts

Have a prompt that works?

Submit yours to the library. We review, version, and publish community contributions alongside our retainer prompts.

Submit a prompt →